(data stored in ACNUC30630 zone)

EMBL: CP000113.PE93

CP000113.PE93        Location/Qualifiers
FT   CDS_pept        complement(110594..111340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAO78078.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87776"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG44"
FT                   /protein_id="ABF87776.1"
FT                   /translation="MSEDAFFTVYGNLPRHGPGSDDCTREALRRLPPLPPHPRVVDLGC
FT                   GAGAQTLVLAEALRTRVIAVDLHEPFLDQLKARARERGLDALIDVQRQDMGALSLPEAS
FT                   FDLLWSEGAIYHLGFGPGLRRWRPLLAPGGLAAVTECTWLTDERPDEIARFWGEVYPTM
FT                   GTVLENRAAAETAGYEVLDTFTLPASAWWDTYYTPLLQRVAHLRAHGDASLEDALSAAE
FT                   QETRLYRQYEHTYGYVFHLLRNPSAL"
     atgagcgaag acgccttctt caccgtctat ggcaacctgc cccgtcacgg ccctggcagc        60
     gacgactgca cccgggaggc cctgcgacgg ctgcctccgc tgccaccgca cccgcgcgtg       120
     gtggacctcg gctgtggcgc gggcgcgcag acgctggtgc tcgccgaggc actgcgcacc       180
     cgggtcatcg cggtggacct gcacgagccc ttcctcgacc aactcaaggc acgagcgcgc       240
     gagcggggcc tggacgcgct catcgacgtt cagcggcagg acatgggcgc actgtcgctg       300
     cccgaggctt cctttgacct cctctggtcc gaaggcgcca tctaccacct gggcttcggt       360
     ccgggactgc ggcgctggcg cccgctgctc gcgcccggcg gcctggctgc cgtcaccgaa       420
     tgcacctggc tgaccgatga gcgccccgac gaaatcgcgc gcttctgggg tgaggtctac       480
     cccaccatgg gtacggtttt ggagaaccgc gccgccgcgg aaaccgcggg ctacgaggtg       540
     ctcgacacct tcacccttcc cgcctccgca tggtgggaca cctactacac gcccctgctc       600
     cagcgcgtcg cacacctgcg cgcccacggt gatgcgtcat tggaagacgc gctctcggcc       660
     gccgagcagg agacccgcct ttatcgccag tacgaacaca cctacggcta cgtgttccat       720
     ctgttacgca acccgtcagc gctttga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page