(data stored in ACNUC30630 zone)

EMBL: CP000113.RECF

CP000113.RECF        Location/Qualifiers
FT   CDS_pept        294790..295932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="MXAN_0246"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by similarity to SP:P29232; match to
FT                   protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92338"
FT                   /db_xref="GOA:Q1DFP6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1DFP6"
FT                   /protein_id="ABF92338.1"
FT                   /translation="MRLLALHVHDFRNLPQVQLTPSAHATIAVGQNGQGKTNLLEALYF
FT                   LATLKPLRAGRLSELVRWGSQGARVTGRFLLKGAEREIAVEVGGGTRQAFVDGKKASSL
FT                   EDYFGGVSVVAFTPDDLEVVKGGPDSRRGFLDRAVFNRFPAFLRESREYARALKNRNRL
FT                   LREGHTVDAVYLEAYDETLAKAGARIYSRRRALMAELAPRAQATFASIGRTVDPAVYNY
FT                   RPAHLEGDFAAADETALAAMLRESLSARLRRDMERGFTSVGPHSDDVSVTLGGRSARAY
FT                   ASQGQQRALVLGWKIAEIENLEAAMGFLPLLLLDDVSSELDPERNAYLMGYLAQSGAQV
FT                   VLTTTDGSLVRGAAADDTLWLDVHGGQVAVRADAEPPPAN"
     gtgcgcctcc tcgcgcttca cgtccacgac ttccggaacc tcccccaggt ccagctcacg        60
     cccagcgccc acgccaccat cgcggtgggg cagaacgggc agggcaagac gaacctgctg       120
     gaggccctct acttcctggc cacgctcaag ccgctgcgcg cggggcgtct gtcggagctg       180
     gtgcgctggg gttcgcaggg cgcgcgggtg acggggcgct tcctgctcaa gggcgccgag       240
     cgtgaaatcg ccgtggaggt gggcggcggc acgcggcagg ccttcgtgga tgggaagaag       300
     gcctccagcc tggaggacta cttcggcggc gtgtccgtgg tggccttcac gccggatgac       360
     ctggaggtgg tgaagggcgg tccggactca cgacgcggct tcctggaccg ggcggtgttc       420
     aaccgcttcc ccgccttcct gcgcgagagc cgcgagtacg cgcgggcctt gaagaaccgc       480
     aaccgcctgc tgcgcgaagg gcacaccgtg gacgcggtgt atctggaggc ctacgacgag       540
     acgctggcga aagctggcgc gcgcatctat tcgcggcggc gcgcgttgat ggcggagctg       600
     gcgcccaggg cgcaggcgac cttcgcctcc attggccgca cggtggaccc agccgtgtac       660
     aactaccgcc ccgcgcatct ggagggcgac ttcgccgccg cggacgaaac ggcgctggcg       720
     gccatgctgc gggagagcct ctccgcgcgc ctgcggcggg acatggagcg gggcttcacc       780
     tcggtggggc cgcactcgga cgacgtctcg gtgacgctgg ggggccgcag cgcgcgggcc       840
     tacgcgagcc agggacagca gcgggcgctg gtgctcggct ggaagatcgc cgaaatcgaa       900
     aacctggagg ccgcgatggg cttcctgccg ctgctgctgc tggacgacgt gtcgagcgag       960
     ctggacccag agcgcaacgc ctacctcatg ggctacctgg cccagagcgg cgcgcaggtg      1020
     gtgctcacca ccacggacgg ctcgctggtg cggggcgcgg cggcggacga cacgctctgg      1080
     ctcgacgtgc acggcgggca ggtggcggtg cgcgcggacg ccgagccgcc tcccgccaac      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page