(data stored in ACNUC30630 zone)

EMBL: CP000113.TOLB

CP000113.TOLB        Location/Qualifiers
FT   CDS_pept        405345..406445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="MXAN_0346"
FT                   /product="tol-pal system beta propeller repeat protein
FT                   TolB"
FT                   /note="identified by match to protein family HMM PF07676"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92118"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFF3"
FT                   /protein_id="ABF92118.1"
FT                   /translation="MRGLERLQRSWPWRARCLTALAVLGVGCSGRCGGTSGSGPLSKEE
FT                   ARSIPGAVIFLSERAGQKDVWKVSPDGVETQLTRGEEDEYPGPLSPDGKSLLVITATEE
FT                   GGLHRQQMRVLPLDGKSPAVPLHPPRARARNASWAPDGTWLVAESDAEGFSDVVRLEPR
FT                   EGGPEVRLTQVPQGCFEPAVSPDGKEVAFVCSREGDPEVYVANADGSGERRLTFFHHED
FT                   RTPKWSPDGKWLVIVSDRERKDRLYFLRPDGSDLRAVSGESFEGDEREAAWSPDGQRLV
FT                   YVSRLPDGNARIWMVAVAGGAPVALTDGKHRDDMPAWSPDGKYLAFVSERQGDTDVYVM
FT                   RADGSGQTRLTTAKGPDWLPRWAPTR"
     atgcggggcc ttgaacggct tcaacgttcc tggccgtggc gggcgcggtg tctgaccgcg        60
     ctcgccgtgc tcggtgtcgg atgttccggc cggtgtggcg ggacgtccgg ctccgggccg       120
     ctgtccaagg aggaggctcg ctccattcca ggcgcggtca tcttcttgtc ggagcgggca       180
     gggcagaagg atgtctggaa ggtgagtccg gacggtgtgg agacgcagct gacgcgcggc       240
     gaggaggacg agtaccccgg tcccctgtcg ccggacggca agtcgctgct cgtcatcacc       300
     gcgacggagg agggcgggct gcaccgccag cagatgcggg tcctgccgct ggatggcaag       360
     agcccggcgg taccgctgca cccgccccgg gcgcgtgcgc gcaacgcgag ctgggcgccg       420
     gatggcacct ggttggtggc cgagtccgac gcggagggct tcagtgacgt ggtgcgcctg       480
     gagccccgtg agggggggcc ggaggtgcgc ctcacgcagg tgccacaagg ctgcttcgag       540
     ccggcggtgt ctccggatgg gaaggaggtg gccttcgtat gcagccgcga gggcgacccc       600
     gaagtctacg tggcgaacgc ggacggcagt ggtgagcgcc gcctcacctt cttccaccat       660
     gaggaccgca cgccgaagtg gagcccggac ggcaagtggc tcgtcatcgt cagcgatcgc       720
     gagcgcaagg accggctgta cttcctccgt ccggacggtt cggacctgcg cgccgtgtcg       780
     ggcgagtcct tcgagggcga cgagcgtgag gccgcctgga gtccggatgg gcaacgactg       840
     gtctacgtga gccgtctgcc ggatgggaac gcccgcatct ggatggtggc ggtggcgggc       900
     ggcgcgccgg tggccctgac ggacggcaag caccgggacg acatgcccgc gtggagtccg       960
     gacgggaagt acctggcctt cgtgtccgag cgccagggcg acacggacgt gtacgtcatg      1020
     cgcgcggatg gcagcgggca gacgcgtctg acgaccgcca aggggccgga ctggctgccg      1080
     cgctgggccc ctacgcgctg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page