(data stored in ACNUC30630 zone)

EMBL: CP000113.TOPB

CP000113.TOPB        Location/Qualifiers
FT   CDS_pept        610214..614896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB"
FT                   /locus_tag="MXAN_0535"
FT                   /product="DNA topoisomerase III/ATP-dependent DNA helicase,
FT                   RecQ family"
FT                   /EC_number="5.99.1.2"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF00570; match to protein family HMM PF01131;
FT                   match to protein family HMM PF01751; match to protein
FT                   family HMM TIGR00614; match to protein family HMM
FT                   TIGR01056"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90073"
FT                   /db_xref="GOA:Q1DEW9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEW9"
FT                   /protein_id="ABF90073.1"
FT                   /translation="MLAEKPSVARDIARVLGANERGEGWLRGNGYVVTWAIGHLVGLAQ
FT                   PHEIRADWKKWSRALLPMLPADWPLVVSKETRSQFEVVKQVLNAPEVSSVVCATDAGRE
FT                   GELIFRYIYDAAKCRKPVQRLWVSSLTERAIQDGFRRLADGREYEALAAAAMGRSRADW
FT                   LVGMNLSRLYTLAHGGHGEMLSVGRVQTPTLAMVVERELAIRDFVPRDYLELVATFAPR
FT                   AKGVPPDALYKGTWFRSGPDGKPVAPPGFEGVREARRLDANGVEAQAIIDRVRAGRAII
FT                   ESLESEEKRMAPPLLYDLTELQRHANRLHGFSAQRTLEVAQALYEKHKLLSYPRTASRH
FT                   LSRTVADTLPEVVNAIRGPYEEDLAVGTGARALGKRYVDDAKVTDHHAIIPTPTAPGGV
FT                   RLSPDEQRVYDLVCRRLLQAWHEDHVWRVTTVITAVTSAGAPPVVDRFQSTGTQVEQVG
FT                   WKVLDIGGGQKAPRLKSEGRKGEDAEREPEDEPQTLPSGLARAQPQSVEDVEAVKKRTR
FT                   PPPRFTDATLLTAMESAGRALDEKELADAMRETGLGTPATRAAIIEVLLDREYLRRRGK
FT                   VMEATEKGIHLIQVVHPDVKTPAMTGQWEAWLQRIERGEGQLDEFIRGIEAYVIEVVGH
FT                   GATAPQRPPRNEVLGAPPGAGWGQGGAAQVASEGAAAAHGAGAGARGPGGQGAFAESSA
FT                   ERFGDASAGGAGRGRQGAFTEASAERFADAAPGVQGQGRPGALSEASEPLFGTRRSRTS
FT                   GSVGRSEPHGEPLSSTMSPGGGAASRLPRADGTGWNAGAWENTGAARAPVNRARTPASA
FT                   ASTGQRPERVRRAPTAPEALRPLLKEAFGFSDFRPYQEAVCRAATAGEDLLLVMPTGAG
FT                   KSLCYQLPGLARAGTTLVVSPLIALMEDQVARLQSLGFAADRIHSGRDRAMSRQVCADY
FT                   LEDRLDFLFIAPERLGVPGFVEFLARRTPALIAVDEAHCISQWGHDFRPDYRLLGARLP
FT                   LLRPAPVVALTATATPDVQRDIVQQLGLQGPGGKARTFIHGFRRTNIAIEVRELNPGAR
FT                   GDAIQGLLEDEENRPAIVYAATRKHAEQLADQLAGEFPAAAYHAGLQPSERDRVQAEFL
FT                   RGSLEVIVATTAFGMGIDKADVRTVIHAALPASLEGYYQELGRAGRDGKPSRAVLLHSY
FT                   IDRRTHEFFHRRDYPEAYVLERLFKSTAPQLEPKAVLQGRVRGDPEVFDKALEQLWIHG
FT                   GVVMTPDETVMRGKPGWSASYSAQRDRKLLHLEQMGRYAEAHGCRMKQLVGHFGDTQDS
FT                   GEPCGLCDVCAPEDCATLRFAEPTSAERHWLERILESLQERDGQATGRLHRELFGESLP
FT                   RRDFERLVGGLVRAGLTRLEVDSFDKDGQVISFQRLALTDEGRRTRAVDPQRVVLPLPL
FT                   EKAAKRKRGKGAEKGTAKRATAKKRTVRAKAGAATRRTASESDEEDSPTHWRANAPSKS
FT                   TAGAPRASRSTGAPSGSASGRRAAAEPSPKMVEALKAWRLAEARKRRVPAFRILTDRVL
FT                   EAIASACPENGSELMAIHGVGPSLTERYGAQILSLVARRS"
     gtgctggcgg agaagccctc ggtggcgcgc gacatcgcgc gggtgctggg ggcgaacgag        60
     cgcggtgagg gctggctgcg cggcaatggc tacgtggtga cgtgggccat cgggcacctg       120
     gtgggcctgg cgcagcccca tgagattcgc gcggactgga agaagtggag ccgcgcgctg       180
     ctgcccatgc tcccggcgga ctggccgctg gtcgtctcca aggagacgcg cagccagttc       240
     gaggtggtga agcaggtgct caacgcgccg gaggtgtcct cggtggtgtg cgcaacggac       300
     gcggggcgcg agggcgagct tatcttccgg tacatctacg acgcggcgaa gtgccgcaag       360
     ccggtacagc ggctgtgggt gtcgtcgctg acggagcggg ccatccagga cggcttccgc       420
     cggctcgcgg acggccgtga atacgaagcg ctggccgccg cggccatggg gcgcagccgg       480
     gcggactggc tggtggggat gaacctgtcg cgcctgtaca cgctggcgca cgggggccat       540
     ggagagatgc tgagcgtggg ccgggtgcag acgcccacgc tggccatggt ggtggagcgc       600
     gagttggcca tccgcgactt cgtgccgcgt gactacctgg agctcgtggc caccttcgcg       660
     cccagggcga agggggttcc gccggacgcg ctgtacaagg gcacgtggtt ccgctcgggg       720
     ccggatggca agcccgtggc gcccccgggc ttcgagggcg tgcgcgaggc gcggcggctg       780
     gatgcgaacg gcgtggaggc gcaggccatc atcgaccggg tgcgcgccgg gcgggccatc       840
     atcgaatcgc tggagtcgga ggagaagagg atggcgcctc cgctcctcta cgacttgacg       900
     gagttgcagc ggcacgccaa ccggctccat ggcttcagcg cgcagcgcac gctggaggtg       960
     gcgcaggcgc tctacgagaa gcacaagctg ttgagctatc cgcgcaccgc cagccggcac      1020
     ctgtcacgca ccgtggcgga cacgctgccg gaggtggtga acgccattcg cgggccctac      1080
     gaggaggacc tggccgtcgg tacgggggct cgggcgctgg gcaagcgcta tgtggatgac      1140
     gcgaaggtga cggaccacca cgccatcatc cccacgccca cggcgccggg cggggtgcgg      1200
     ctgtctccgg acgagcagcg cgtctatgac ctggtgtgcc ggcgtctgct ccaggcgtgg      1260
     cacgaggacc acgtctggcg ggtcaccacg gtcatcaccg cggtgacgtc ggcaggggcg      1320
     ccgcccgtgg tggaccgctt ccagagcacg ggcacccagg tggagcaggt gggctggaag      1380
     gtgctggaca ttggcggcgg acagaaggcg ccgcggctga agtcggaggg gcgcaagggc      1440
     gaggacgcgg agcgggagcc ggaggacgag ccccagacgc tgccgtcggg gttggcgcgc      1500
     gcgcagccgc agtccgtgga ggacgtggag gcggtgaaga agcgcacgcg tccgcctccc      1560
     cgcttcacgg atgcgacgct gctgacggcc atggagtcgg cggggcgggc gttggatgag      1620
     aaggagctcg cggacgcgat gcgcgagacg ggcctgggga ctcccgccac ccgcgcggcc      1680
     atcatcgagg tgctgctgga ccgcgagtac ctgcgccgcc ggggcaaggt gatggaggcc      1740
     acggagaagg gcatccatct catccaggtg gtgcacccgg atgtgaagac gccggccatg      1800
     acgggccagt gggaggcgtg gctccagcgc atcgagcgcg gcgaaggcca gctcgatgag      1860
     ttcatccgtg gcatcgaggc gtatgtcatc gaggtggtgg gccatggcgc caccgcgccg      1920
     caacggcctc cgcgcaacga ggtgttgggg gctccacctg gagcaggttg ggggcagggc      1980
     ggcgcggcgc aggtggcgag cgagggcgcg gccgcggcgc acggcgctgg cgcgggagcg      2040
     cgtggccctg gcgggcaggg ggcgttcgcg gagtcctctg ctgagcgttt cggggatgct      2100
     tcggcggggg gggcggggcg tggccggcag ggggcgttca cggaggcttc tgccgagcgc      2160
     ttcgcggatg ccgcgccggg tgtgcaggga cagggacgcc cgggcgcgct ctcggaggct      2220
     tcggagccgc tcttcgggac gcggcggagc aggacctcgg gctccgtggg tcgctcggag      2280
     cctcatggcg agccgctgtc ctccaccatg tcaccgggcg gaggcgcggc ctcgcgtctt      2340
     cctcgggcgg acggcacagg ctggaacgcc ggggcctggg agaacacggg cgctgctcgc      2400
     gctccagtga accgtgcgag gaccccggcg tcagccgcgt ccaccgggca gcggccggag      2460
     cgcgtgcggc gcgcaccgac ggcgcccgag gcgctgcgtc cgctgctgaa ggaggcgttc      2520
     ggcttctcgg acttccggcc gtatcaggag gccgtgtgcc gcgcggccac ggcgggagag      2580
     gacctgctgc tcgtgatgcc cacgggcgcg ggcaagtcgc tctgctatca gttgccgggt      2640
     ctggcgcgcg caggcaccac gctggtggtg agtccgctca tcgcgctgat ggaggaccag      2700
     gtggcgcggc tccagtcgct cggcttcgcg gcggaccgca tccactccgg aagagaccgg      2760
     gccatgtcgc ggcaggtgtg cgcggactac ctggaggacc ggctcgactt cctgttcatc      2820
     gcgcccgagc ggctcggcgt tccgggcttc gtggagttcc tggcgcgccg cacgcccgcg      2880
     ctcatcgcgg tggacgaggc ccactgcatc tcccagtggg gacacgactt ccgcccggac      2940
     tatcgactcc tgggcgcgcg tttgcccctg ctgcgccccg cgcccgtggt ggcgctcacc      3000
     gccaccgcca cgccggacgt gcagcgggac atcgttcagc agctcggcct gcaaggcccc      3060
     gggggcaagg cgcgcacctt cattcacggc ttccgccgca ccaacatcgc catcgaggtg      3120
     cgggagctga accccggcgc gcgcggcgac gccatccagg gattgctcga ggacgaggag      3180
     aaccggcccg cgattgtcta cgcggccacg cgcaagcacg ccgagcagct cgcggaccag      3240
     ctcgcgggcg agttccccgc ggccgcctat cacgcggggc tccagccttc ggagcgagat      3300
     cgggtgcagg ccgagttcct ccggggctcg ctggaggtca tcgtggccac cacggcgttc      3360
     ggcatgggca tcgacaaggc ggacgtgcgc accgtcatcc acgcggcgct ccccgccagc      3420
     ctggagggct actaccagga gctgggccgc gcgggccgcg atgggaagcc gtcgcgcgcg      3480
     gtgctgctgc attcgtacat cgaccggcgc acgcacgagt tcttccaccg gcgcgactac      3540
     ccggaggcgt acgtgctgga gcggctgttc aagtccacgg cgccgcagct cgagcccaag      3600
     gccgtgctcc agggccgcgt gcgaggagac cccgaggtct tcgacaaggc actggagcag      3660
     ctctggattc acggcggcgt cgtcatgacg cctgacgaga cggtgatgcg cgggaagccg      3720
     ggctggtccg cgtcgtactc ggcccagcgc gatcgcaaac tgctgcacct ggagcagatg      3780
     gggcgctacg cggaggccca tggctgccgc atgaagcagc tcgtggggca cttcggtgac      3840
     acccaggatt cgggtgagcc gtgcggcctg tgtgatgtct gcgcgccgga ggactgcgcc      3900
     acgctgcgct tcgccgagcc gacctccgcg gagcggcact ggctggagcg catcctggag      3960
     tcgctccagg agcgggacgg acaggccacc ggaaggctcc accgcgagtt gtttggagag      4020
     tccctgccac ggcgcgactt cgagcgactg gtgggcggac tggttcgcgc cgggctgacg      4080
     cgcttggagg tggactcgtt cgacaaggac gggcaggtca tttcgttcca gcgtctcgcc      4140
     ctgacggacg agggccggcg cacgcgcgcg gtggaccccc agcgagtggt cctgccgttg      4200
     cccctggaga aggccgcgaa gcgcaagcgg ggcaagggcg cggagaaggg caccgcgaag      4260
     cgggccacgg ccaagaaacg cacggtccgc gccaaggccg gggccgcgac gcggcgcacg      4320
     gcatccgaat ccgatgagga agactcgccg acgcactggc gcgcgaacgc tccctcgaag      4380
     agcaccgccg gggcgccacg tgcgtcccgg agcacggggg ctccgagtgg ctccgcgtca      4440
     ggccgccgcg ccgcggccga gccttctccg aagatggtgg aggccttgaa ggcctggcgg      4500
     ctcgcggagg cgcgcaagcg gcgggtgcct gccttccgca tcctcacgga ccgggtgctg      4560
     gaggccatcg cgtcggcctg tccggagaat ggctcggagt tgatggccat ccacggggtg      4620
     gggccctccc tcacggagcg ctacggcgcg cagattcttt ccctcgtggc gcgcaggagc      4680
     tga                                                                    4683
//

If you have problems or comments...

PBIL Back to PBIL home page