(data stored in SCRATCH9089 zone)

EMBL: CP000124.ACEK

CP000124.ACEK        Location/Qualifiers
FT   CDS_pept        complement(593701..595512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceK"
FT                   /locus_tag="BURPS1710b_0581"
FT                   /product="isocitrate dehydrogenase kinase/phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /EC_number="2.7.11.5"
FT                   /note="identified by match to protein family HMM PF06315"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49915"
FT                   /db_xref="GOA:Q3JWQ8"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JWQ8"
FT                   /protein_id="ABA49915.1"
FT                   /translation="MNHFPKLLSSQIGFDVAQTILENFDRHYRIFREAAVEAKDLFERA
FT                   DWHGLQRLARERITSYDDRVRECVELLEDEYDAENIDNEVWPQIKLHYIGLLTSHRQPE
FT                   CAETFFNSVCCKILHRAYFNNDFIFVRPAISTEYIENDEPAAKPTYRAYYPGSEGLAAT
FT                   LERIVTNFQLNPPFEDLERDIACIMQAIHDEFGAFDEAVNFQIHVLSSLFYRNKTAYVV
FT                   GRIINGDRVLPFAVPIRHARAGILALDTVLLRRDQLKIIFSFSHSYFLVDMNVPSAYVQ
FT                   FLRSIMPGKPKAEIYTSVGLQKQGKNLFYRDLLHHLSHSSDRFIVAPGIKGLVMLVFTL
FT                   PSFPYVFKMIKDHFPPPKDTTREQIMAKYLLVKRHDRLGRMADTLEYSSVALPLARLDD
FT                   ALVRELEKEVPSLIEYEGENLVIKHLYIERRMVPLNLYLQNGSDAEIEHGVREYGNAVK
FT                   ELMQANIFPGDMLYKNFGVTRHGRVVFYDYDEIEYLTDCNVRRVPPPRNDEDEMSGEPW
FT                   YTVGPHDIFPETYAPFLLGDPRVREHFLAHHADFFDPQLWQDSKDRLLRGELPDFFAYE
FT                   PALRFCIRYPERFAPGDAADGGKLAAA"
     atgaatcact ttcccaaact gctgtcctcg cagatcggct ttgacgtcgc gcagacgatc        60
     ctcgagaact tcgatcgcca ctaccggatc ttccgcgaag cggccgtcga agcgaaggac       120
     ctgttcgagc gcgcggactg gcacgggctg cagcggctcg cgcgcgagcg catcacgtcg       180
     tacgacgacc gcgtgcgcga atgcgtcgag ctgctcgagg acgagtacga cgcggagaac       240
     atcgacaacg aagtctggcc gcagatcaag ctgcattaca tcggcctgct cacgtcgcac       300
     cgccagcccg aatgcgcgga gacgttcttc aattcggtgt gctgcaagat cctgcaccgc       360
     gcgtacttca acaacgattt catcttcgtg cgcccggcga tctcgaccga atacatcgag       420
     aacgacgagc ccgccgcgaa gcccacgtac cgcgcgtact atccgggcag cgaggggctc       480
     gccgcgacgc tcgagcggat cgtcacgaac ttccagctca atccgccgtt cgaggatctc       540
     gagcgcgaca tcgcgtgcat catgcaggcg atccacgacg agttcggcgc gttcgacgaa       600
     gcggtgaatt tccagatcca cgtgctgtcg tcgctgttct accggaacaa gaccgcgtac       660
     gtcgtcggcc gcatcatcaa cggcgaccgc gtgctgccgt tcgcggtgcc gatccgccac       720
     gcgcgcgcgg gcatcctcgc gctcgacacc gtgctcctgc gccgtgacca gttgaagatc       780
     atcttcagct tctcgcactc gtatttcctc gtcgacatga acgtgccctc cgcgtatgtg       840
     cagttcctgc gctcgatcat gccgggcaag ccgaaggcgg agatctacac gtcggtcggc       900
     ctgcagaagc agggcaagaa cctgttctat cgcgacctgc tgcatcacct gtcgcattcg       960
     agcgaccgct tcatcgtcgc gcccggcatc aaggggctcg tgatgctcgt gttcacgctg      1020
     ccgtcgttcc cgtacgtgtt caagatgatc aaggatcact tcccgccgcc gaaggacacg      1080
     acgcgcgagc agatcatggc caagtacctg ctcgtcaagc gccacgaccg tctcggccgg      1140
     atggccgaca cgctcgaata ctcgagcgtc gcgctgccgc tcgcgcggct cgacgacgcg      1200
     ctcgtgcgcg agctcgaaaa ggaagtgccg tcgctgatcg aatacgaggg cgagaacctc      1260
     gtcatcaagc acctgtacat cgagcgccgg atggtgccgc tcaacctgta tctgcaaaac      1320
     ggcagcgatg ccgagatcga gcacggcgtg cgcgaatacg gcaatgcggt gaaggagctg      1380
     atgcaggcca acatcttccc cggcgacatg ctgtacaaga acttcggcgt gacgcgccac      1440
     gggcgcgtcg tgttctacga ctacgacgag atcgaatacc tgaccgactg caacgtgcgc      1500
     cgcgtgccgc cgccgcgcaa cgacgaagac gagatgtcgg gcgagccgtg gtacacggtc      1560
     ggcccgcacg acatcttccc cgaaacctac gcgccgttcc tgctcggcga cccgcgcgtg      1620
     cgcgagcact tcctcgcgca tcacgcggat ttcttcgatc cgcagctctg gcaggacagc      1680
     aaggaccgcc tgctgcgcgg cgagctgccc gatttcttcg cctacgagcc ggcgctgcgc      1740
     ttttgcatcc gctatccgga gcgcttcgcg ccgggcgacg cggccgacgg cggcaagctc      1800
     gccgccgcgt ga                                                          1812
//

If you have problems or comments...

PBIL Back to PBIL home page