(data stored in SCRATCH9089 zone)

EMBL: CP000124.AHCY

CP000124.AHCY        Location/Qualifiers
FT   CDS_pept        complement(60670..62091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="BURPS1710b_0057"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="identified by match to protein family HMM PF00670;
FT                   match to protein family HMM PF02826; match to protein
FT                   family HMM PF05221; match to protein family HMM TIGR00936"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47924"
FT                   /db_xref="GOA:Q3JY79"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="PDB:3D64"
FT                   /db_xref="PDB:3GLQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JY79"
FT                   /protein_id="ABA47924.1"
FT                   /translation="MNAAVIDSHSAQDYVVADIALAGWGRKELNIAETEMPGLVQIRDE
FT                   YKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAIVEAGT
FT                   PVFAFKGESLDEYWEFSHRIFEWPNGEFANMILDDGGDATLLLILGSKAEKDRSVIARP
FT                   TNEEEVALFKSIERHLEIDGSWYSKRLAHIKGVTEETTTGVHRLYQMEKDGRLPFPAFN
FT                   VNDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKIAVVAGYGDVGKGCAQSLRGLGAT
FT                   VWVTEIDPICALQAAMEGYRVVTMEYAADKADIFVTATGNYHVINHDHMKAMRHNAIVC
FT                   NIGHFDSEIDVASTRQYQWENIKPQVDHIIFPDGKRVILLAEGRLVNLGCATGHPSFVM
FT                   SNSFTNQTLAQIELFTRGGEYANKVYVLPKHLDEKVARLHLARIGAQLSELSDDQAAYI
FT                   GVSKAGPFKPDHYRY"
     atgaacgccg ctgtcatcga ttcccattcc gcacaagatt acgtcgtcgc cgatatcgcg        60
     ctggccggct ggggccgcaa ggaactgaac atcgccgaga ccgagatgcc cgggctcgtg       120
     cagatccgcg acgaatacaa ggcgcagcag ccgctgaagg gcgcgcgcat cgccggctcg       180
     ctgcacatga cgatccagac gggcgtgctg atcgagacgc tgaaggcgct cggcgcggac       240
     gttcgctggg cgtcgtgcaa catcttctcg acgcaggacc acgcggccgc cgcgatcgtc       300
     gaggccggca cgcccgtctt cgcgttcaag ggcgaatcgc tcgacgaata ctgggagttc       360
     tcgcaccgca tcttcgaatg gccgaacggc gagttcgcga acatgatcct tgatgacggc       420
     ggcgacgcaa cgctgctgct gatcctcggc tcgaaggccg agaaggaccg ctcggtgatc       480
     gcccggccga ccaacgagga agaagtcgcg ctcttcaagt cgatcgagcg ccacctcgaa       540
     atcgacggca gctggtactc gaagcgcctc gcgcacatca agggcgtgac cgaagagacg       600
     acgacgggcg tgcaccgcct gtaccagatg gaaaaggacg gccgcctgcc gttcccggcg       660
     ttcaacgtca acgattccgt gacgaaatcg aagttcgaca acctgtacgg ctgccgcgag       720
     tcgctcgtcg acggcatcaa gcgcgcgacc gacgtgatga tcgcgggcaa gatcgcggtg       780
     gtcgcgggct acggcgacgt gggcaagggc tgcgcgcaat cgctgcgcgg cctgggcgcg       840
     accgtgtggg tgaccgaaat cgatccgatc tgcgcgctgc aggcggcgat ggaaggctac       900
     cgcgtcgtga cgatggaata cgcggccgac aaggccgaca tcttcgtgac ggcgaccggc       960
     aactaccacg tgatcaacca cgatcacatg aaggcgatgc gccataacgc gatcgtctgc      1020
     aacatcggtc acttcgattc ggaaatcgac gtcgcgtcga cccgccagta ccagtgggaa      1080
     aacatcaagc cgcaggtcga ccacatcatc ttcccggacg gcaagcgcgt gatcctgctg      1140
     gccgaaggcc gcctcgtgaa cctcggctgc gcgaccggcc acccgtcgtt cgtgatgtcg      1200
     aactcgttca cgaatcagac cctcgcgcag atcgagctgt tcacgcgcgg cggcgagtac      1260
     gccaacaagg tgtacgtgct gccgaagcat ctcgacgaaa aggtcgcgcg cctgcacctc      1320
     gcgcgcatcg gcgcgcagct ctccgagctg tcggacgatc aggcggcgta catcggcgtg      1380
     tcgaaggcgg gcccgttcaa gccggatcac tatcgttact ga                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page