(data stored in SCRATCH9089 zone)

EMBL: CP000124.ARGC

CP000124.ARGC        Location/Qualifiers
FT   CDS_pept        27002..27946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="BURPS1710b_0023"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM TIGR01851"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48897"
FT                   /db_xref="GOA:Q3JYB2"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYB2"
FT                   /protein_id="ABA48897.1"
FT                   /translation="MSTRVFVDGQEGTTGLKIFEYLLARSDIDILRIDEAKRKDVDERR
FT                   RLINASDVTFLCLPDVASRESATLVENPNTTLIDASTAFRTSADWAYGLPELNRAQRER
FT                   IRGAKRIAVPGCHASAFVLAMRPLVDAGVVAPGFAAHSYSITGYSGGGKKMIADYEAGG
FT                   AKLASPRPYALGLAHKHLPEMAAHTGLTSAPIFTPIVGPFYKGLAVTTYFTPGQLAKRV
FT                   TPQDVQRVLAEHYAGEAFVRVAPYDAAENLDDGFFDVQANNDTNRVDLFVFGTAERFVT
FT                   VARLDNLGKGASGAAIQCMNLNVGAAEGTGLAR"
     atgagcacga gagtttttgt cgacggccag gaaggcacga ccggtctgaa gatcttcgaa        60
     tatctgttgg cgcgcagcga catcgacatc ctgcgcatcg acgaagcgaa gcgcaaggac       120
     gtcgacgagc gccgccgcct catcaacgcg tcggacgtga cgttcctgtg cctgcccgac       180
     gtcgcgtcgc gcgaatcggc gacgctcgtc gagaacccga acacgacgct gatcgacgcg       240
     agcaccgcgt tccgcacgag cgccgactgg gcatacggcc ttcccgagct gaaccgcgcg       300
     cagcgcgagc gcatccgtgg cgcgaagcgc atcgcggtgc cggggtgtca cgcgtcggcg       360
     ttcgtgctgg cgatgcgtcc gctcgtcgac gcgggcgtgg tcgcgccggg cttcgccgcg       420
     cacagctatt cgatcacggg ctacagcggc ggcggcaaga agatgatcgc cgattacgaa       480
     gcgggcggcg cgaagctcgc gagcccgcgt ccgtatgcgc tcggcctcgc gcacaagcat       540
     ctgccggaga tggccgcgca tacgggcctc acgagcgcgc cgatcttcac gccgatcgtc       600
     gggccgttct acaagggcct cgccgtcacc acgtacttca cgccgggcca gctcgcgaag       660
     cgcgtgacgc cgcaggacgt gcagcgcgtg ctcgccgagc attacgcggg cgaggcgttc       720
     gtgcgcgtcg cgccgtacga cgcggccgag aatctcgacg atggcttctt cgacgtgcag       780
     gcgaacaacg acacgaaccg cgtcgacctg ttcgtgttcg gcacggcgga acgcttcgtc       840
     accgtcgcgc ggctcgacaa cctcggcaag ggcgcgtcgg gcgccgcgat ccagtgcatg       900
     aatctcaacg tcggcgcggc cgagggtacg gggctcgcgc gctga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page