(data stored in SCRATCH9089 zone)

EMBL: CP000124.ARGT

CP000124.ARGT        Location/Qualifiers
FT   CDS_pept        complement(161729..162523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argT"
FT                   /locus_tag="BURPS1710b_0156"
FT                   /product="lysine-arginine-ornithine-binding periplasmic
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51042"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXY1"
FT                   /protein_id="ABA51042.1"
FT                   /translation="MKRLQFWFALACALGAATGAGAARADASQTLRFGLEAQYPPFESK
FT                   AANGALQGFDIDVGNAVCNAAKLTCKWVETSFDGLIPALQGRKFDAINSAMNATDQRRQ
FT                   AIDFTTVIYRVPTQLIARADSGLEPTPASLKGKRVGVLQGSIQEAYANAHWAGAGVQVV
FT                   AYQDQNQAYADLTAGRLDGTLVLAPAGQRGFLSRPEAKGFAFVGPPVRDDKILGSGIAF
FT                   GLRKGDDVLKARLNAAIDKLKADGAVKALGRKYFGDIDISAK"
     atgaaacgat tgcaattctg gttcgcgctc gcctgtgcat tgggcgccgc cacgggggcc        60
     ggcgcggcgc gcgccgacgc gtcgcaaacg ctgcgcttcg gcctcgaggc gcagtatccg       120
     ccgttcgaat cgaaggcggc gaacggcgcg ctgcagggct tcgatatcga cgtcggcaac       180
     gccgtctgca acgcagcgaa gctcacgtgc aaatgggtcg agacgtcgtt cgacgggctg       240
     attccggcgc tgcagggccg caagttcgat gcgatcaatt ccgcgatgaa cgcaaccgac       300
     cagcgccgtc aggcgatcga tttcacgacg gtgatctatc gcgtgccgac gcaactgatc       360
     gcgcgcgcgg acagcggcct cgagccgacg ccggcatcgc tgaagggcaa acgggtgggc       420
     gtgctgcagg gttcgattca ggaggcgtat gcgaatgcgc actgggcggg cgcgggcgtg       480
     caggtggtcg cgtaccagga tcagaaccag gcgtatgcgg acctcacggc gggccgcctc       540
     gacggcacgc tcgtgctcgc gccggcgggc cagcgcggct tcctgtcgcg gccggaggcg       600
     aagggcttcg cgttcgtcgg gccgccggtg cgcgacgaca agattctcgg cagcggcatc       660
     gcgttcgggc tgcgcaaggg cgatgatgtg ctgaaggcgc gcctgaatgc cgcgatcgac       720
     aaactgaagg cggacggcgc cgtgaaggcg ctcggccgca agtacttcgg cgacatcgac       780
     atctcggcga agtga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page