(data stored in SCRATCH9089 zone)

EMBL: CP000124.ATPD

CP000124.ATPD        Location/Qualifiers
FT   CDS_pept        complement(182871..184265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="BURPS1710b_0179"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM TIGR01039"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48562"
FT                   /db_xref="GOA:Q3JXV8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXV8"
FT                   /protein_id="ABA48562.1"
FT                   /translation="MSTAALVEGKIVQCIGAVIDVEFPRESMPKIYDALILEGSELTLE
FT                   VQQQLGDGVVRTICLGASDGLRRGVVVKNTGNPISVPVGKPTLGRIMDVLGRPIDEAGP
FT                   IESENKRSIHQKAPAFDELSPSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNM
FT                   MELINNIAKEHGGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLR
FT                   VALTGLTMAEHFRDEGLDVLFFVDNIYRFTLAGTEVSALLGRMPSAVGYQPTLAEEMGK
FT                   LQERITSTKKGSITSVQAVYVPADDLTDPSPATTFGHLDATVVLSRDIASLGIYPAVDP
FT                   LDSTSRQIDPNVIGEEHYSITRRVQQTLQRYKELRDIIAILGMDELSPEDKLSVARARK
FT                   IQRFLSQPFHVAEVFTGSPGKYVPLKETIRGFKMIVDGECDHLPEQAFYMVGTIDEAFE
FT                   KAKKIQ"
     atgagtactg ctgctttggt agaaggcaag atcgtacagt gcatcggcgc cgttatcgac        60
     gtggaattcc cgcgcgagag catgccgaag atctacgacg cgctcattct ggaaggctcg       120
     gaactgacgc tcgaagtcca gcagcagctg ggcgacggcg tggtccgtac catctgtctg       180
     ggtgcctccg acggcctgcg ccgcggcgtc gtggtgaaga atacgggcaa tccgatttcg       240
     gtgccggtcg gcaagccgac cctcggccgc atcatggacg tgctcggccg cccgatcgac       300
     gaagcgggac cgatcgagag cgaaaacaag cgctcgatcc accagaaggc gccggcgttc       360
     gacgagctgt cgccgtcgac cgaactgctc gaaacgggca tcaaggtcat cgatctgatc       420
     tgcccgttcg caaagggcgg caaggtcggc ctgttcggcg gcgcgggcgt gggcaagacc       480
     gtcaacatga tggagctcat caacaacatc gcgaaggagc acggcggtta ctccgtgttc       540
     gcgggcgtgg gcgagcgtac ccgtgaaggg aacgacttct accacgaaat gaaggactcg       600
     aacgttctcg acaaggtcgc gctggtgtac ggccagatga acgagccgcc gggcaaccgt       660
     ctgcgcgtgg cgctgacggg cctcacgatg gccgagcact tccgtgacga aggcctcgac       720
     gtgctgttct tcgtcgacaa catctaccgt ttcacgctgg ccggtaccga agtgtcggcg       780
     ctgctcggcc gtatgccgtc ggcagtgggc tatcagccga cgctggctga agaaatgggc       840
     aagctgcaag agcgcatcac gtcgacgaag aaaggctcga tcacgtcggt tcaggccgtg       900
     tacgtgcctg cggacgactt gaccgacccg tcgccggcca ccaccttcgg ccacttggac       960
     gcaaccgtcg ttctgtcgcg tgacatcgca tcgctcggta tctatccggc cgtcgacccg      1020
     ctcgactcga cgtcgcgcca gatcgacccg aacgtgatcg gcgaagagca ctactcgatc      1080
     acccgccgcg ttcagcagac gctgcagcgc tacaaggaac tgcgcgacat catcgcgatt      1140
     ctgggcatgg acgagctgtc gccggaagac aagctgtcgg ttgcgcgcgc acgtaagatc      1200
     cagcgtttcc tgtcgcagcc gttccacgtc gccgaagtgt tcacgggctc gccgggcaag      1260
     tacgtgccgc tgaaggaaac gatccgcggc ttcaagatga tcgtcgacgg cgagtgcgac      1320
     cacctgccgg aacaggcgtt ctacatggtc ggcacgatcg acgaagcctt cgagaaggcc      1380
     aagaagatcc agtaa                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page