(data stored in SCRATCH9089 zone)

EMBL: CP000124.ATPE

CP000124.ATPE        Location/Qualifiers
FT   CDS_pept        complement(188020..188289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="BURPS1710b_0184"
FT                   /product="ATP synthase c chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00137;
FT                   match to protein family HMM TIGR01260"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48231"
FT                   /db_xref="GOA:Q3JXV3"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXV3"
FT                   /protein_id="ABA48231.1"
FT                   /translation="MQAFIANIQGLTAIGIGIIIGLGAIGACIGIALMGGKYIEACARQ
FT                   PELINPLQTKMFLLAGLIDAAFLIGVGVAMLFAFANPLLSKLAG"
     atgcaagctt tcatcgccaa catccaaggt ctgaccgcca tcggtatcgg catcatcatc        60
     ggcctgggtg caatcggcgc ctgtatcggt atcgcgctga tgggcggcaa gtacatcgaa       120
     gcctgcgcgc gtcagccgga actcatcaac ccgctgcaaa cgaagatgtt cctgctggct       180
     ggtctgatcg acgcggcgtt cctgatcggc gtcggtgtgg ccatgctgtt tgcattcgcg       240
     aacccgctcc tgtcgaagct cgcaggctaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page