(data stored in SCRATCH9089 zone)

EMBL: CP000124.BCRA

CP000124.BCRA        Location/Qualifiers
FT   CDS_pept        246173..247735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcrA"
FT                   /locus_tag="BURPS1710b_0235"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49050"
FT                   /db_xref="GOA:Q3JXQ2"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ2"
FT                   /protein_id="ABA49050.1"
FT                   /translation="MAATAPASPSRSAEPAPLSGGTLALLTIGLALGTFMEVLDTSIAN
FT                   VAVPTISGSLGVATSEGTWVISSYSVASAIAVPLTGWLARRVGEVRLFTLSVLAFTIAS
FT                   ALCGLAENFETLIAFRLLQGLVSGPMVPLSQTILMRSYPPAKRGLALGLWAMTVIVAPI
FT                   FGPLLGGWISDNYTWPWIFYINLPIGVFSAACAFFLLRGRETKTTKQRIDAIGLALLVI
FT                   GVSCLQMMLDLGKDRDWFNSTFITSLALIAVVSLAFMLVWESTEKEPVVDLSLFKDRNF
FT                   ALGAMIISFGFMAFFGSVVIFPLWLQTVMGYTAGLAGLATAPVGILALVLSPMIGRNMH
FT                   RLDLRMVASFAFVVFAVVSIWNSMFTLDVPFNHVILPRLVQGIGVACFFVPMTTITLSS
FT                   IPDERLASASGLSNFLRTLSGAIGTAVSSTFWENDAIYHHARLAESVNVYAQSTLDYQG
FT                   ALARLGVMGDVSTAQINQIVTQQGFMMATNDFFHISALAFVALAALVWVTKPKKGAGPA
FT                   IGH"
     atggctgcga cggcccccgc ttccccttcc cgctccgccg agccggcgcc gctgtcgggc        60
     ggcacgctcg cgctgctgac gatcgggctc gcgctcggca cgttcatgga ggtgctcgac       120
     acgtcgatcg cgaatgtcgc ggtgccgacg atctccggca gcctcggcgt cgcgacgagc       180
     gaaggcacgt gggtgatctc gtcgtattcg gtcgcctccg cgatcgcggt gccgctgacc       240
     ggctggctcg cgcggcgggt cggcgaggtg cggctgttca cgctgtcggt gctcgcgttc       300
     acgatcgcgt ccgcgctctg cggcctcgcg gagaacttcg agacgctgat cgcgttccgg       360
     ctgttgcagg ggctcgtgtc ggggccgatg gtgccgctgt cgcagacgat cctgatgcgc       420
     agctatccgc ccgcgaagcg cgggctcgcg ctcggcctgt gggcgatgac ggtgatcgtc       480
     gcgccgatct tcggcccgct gctcggcggc tggatcagcg acaactacac gtggccgtgg       540
     atcttctata tcaacctgcc gatcggcgtg ttctccgccg cgtgcgcgtt cttcctgttg       600
     cgcggccgcg agacgaagac gacgaagcag cggatcgacg cgatcgggct cgcgctgctc       660
     gtgatcggcg tgtcgtgcct gcagatgatg ctcgacctcg gcaaggatcg cgactggttc       720
     aactcgacgt tcatcacctc gctcgcgctg atcgccgtcg tgtcgctcgc gttcatgctc       780
     gtgtgggaat ccaccgagaa ggagccggtc gtcgacctgt cgctcttcaa ggaccgcaac       840
     ttcgcgctcg gcgcgatgat catctcgttc ggcttcatgg cgttcttcgg ctcggtcgtg       900
     atctttccgc tgtggctgca gaccgtgatg ggctacacgg cgggcctcgc cggcctcgcc       960
     acggcgcccg tcggcatcct cgcgctcgtg ctctcgccga tgatcggccg caacatgcac      1020
     cggctcgatc tgcggatggt cgcgagcttc gcgttcgtcg tgttcgccgt cgtgtcgatc      1080
     tggaattcga tgtttacgct cgacgtgccg ttcaaccatg tgatcctgcc gcggctcgtg      1140
     cagggcatcg gcgtcgcgtg ctttttcgtg ccgatgacga cgatcacgct ctccagcatt      1200
     cccgacgagc ggctcgcgag cgcgtcgggg ctgtcgaact tcctgcgtac gctgtcgggc      1260
     gcgatcggca ccgcggtgag ctcgacgttc tgggaaaacg acgcgatcta tcaccacgcg      1320
     cggctcgccg aatcggtgaa cgtgtatgcg cagagcacgc tcgactatca aggcgcgctc      1380
     gcgcggctcg gcgtgatggg cgacgtgtcg accgcgcaga tcaaccagat cgtcacgcag      1440
     cagggcttca tgatggcgac caacgacttc ttccacattt cggcgctcgc gttcgtcgcg      1500
     ctcgcggcgc tcgtgtgggt gacgaagccg aagaaagggg ccgggcccgc gatcgggcac      1560
     tga                                                                    1563
//

If you have problems or comments...

PBIL Back to PBIL home page