(data stored in SCRATCH9089 zone)

EMBL: CP000124.BPRA

CP000124.BPRA        Location/Qualifiers
FT   CDS_pept        complement(50749..51126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bprA"
FT                   /locus_tag="BURPS1710b_0048"
FT                   /product="H-NS histone family protein"
FT                   /note="identified by match to protein family HMM PF00816"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49808"
FT                   /db_xref="GOA:Q3JY88"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY88"
FT                   /protein_id="ABA49808.1"
FT                   /translation="MTQLSEASLVKMASRPKIGAIWSDKREFMSSYKDLLAQREKLEKQ
FT                   IEEAKSREYAEVLSDVKQKIADYGFTLAELGLGRGKAGKAGRPRAGVAAKYRDPESGAT
FT                   WSGRGKPPRWIAGKNREQFAI"
     ttgacccaat tatccgaggc atcgttagtt aagatggcaa gccggcccaa gatcggcgcc        60
     atttggtcag ataaaaggga atttatgtct tcttacaagg accttctcgc tcagcgagag       120
     aagctggaga agcagatcga agaagccaag tcgcgcgaat acgcggaggt attgagcgac       180
     gtcaagcaaa agatcgccga ttacggtttc acgctcgcgg aactcggtct cggtcgtggc       240
     aaagctggaa aagcggggcg accccgcgct ggcgtcgcgg cgaaataccg cgatccggaa       300
     tccggcgcaa cctggtcggg ccgcgggaag cctcctcgct ggatcgccgg caagaatcgc       360
     gaacaattcg cgatctga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page