(data stored in SCRATCH9089 zone)

EMBL: CP000124.CHEB

CP000124.CHEB        Location/Qualifiers
FT   CDS_pept        complement(73955..75049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB"
FT                   /locus_tag="BURPS1710b_0071"
FT                   /product="chemotaxis protein-glutamate methylesterase
FT                   protein CheB"
FT                   /EC_number="3.1.1.61"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF01339"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48480"
FT                   /db_xref="GOA:Q3JY65"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JY65"
FT                   /protein_id="ABA48480.1"
FT                   /translation="MQKKIKVLCVDDSALIRSLMTEIINSQPDMEVCATAPDPLVAREL
FT                   IKQHNPDVLTLDVEMPRMDGLDFLEKLMRLRPMPVVMVSSLTERGSEITLRALELGAVD
FT                   FVTKPRVGIRDGMLDYSEKLADKVRAASRARVRQNPQPHAAAAAAAHGHAGAAAPLINN
FT                   PLVSTEKLIIVGASTGGTEAIREVLTPLPPDAPAVLIAQHMPPGFTRSFAQRLNGLCRI
FT                   SVKEAEHGERVLPGHAYIAPGHAHLLLARSGANYIAHLSDEPPVNRHRPSVDVLFRSAA
FT                   QHAGKNALGVILTGMGRDGAAGLLEMKKAGAYTFAQDEASCVVFGMPREAIAMGGVDDV
FT                   APLSDMSRRIMARLASMGDRVQRV"
     gtgcagaaga aaatcaaagt gctgtgcgtc gacgattcgg cgctgatccg cagcctgatg        60
     acagaaatca tcaacagcca gcccgacatg gaagtgtgcg caacggcgcc cgatccgctc       120
     gtggcgcgcg agctgatcaa gcagcacaac ccggacgtgc tgacgctcga cgtcgaaatg       180
     ccgcggatgg acgggctcga cttccttgaa aagctgatgc gcctgcggcc gatgccggtc       240
     gtgatggtgt cgtcgctcac cgagcgcggc tcggagatca cgctgcgcgc gctcgagctg       300
     ggcgcggtcg atttcgtgac gaagccgcgc gtcgggattc gcgacggcat gctcgactat       360
     tcggaaaagc tggccgacaa ggtgcgcgcg gcatcgcgcg cgcgcgtgcg gcagaatccg       420
     cagccgcatg cggcggccgc cgcggccgcg cacggccacg cgggcgccgc cgcgccgctc       480
     atcaacaatc cgcttgtcag taccgagaag ctgatcatcg tcggcgcgtc cacgggcggc       540
     accgaggcga tccgcgaagt gctgacgccg ctgccgcccg atgcgcccgc cgtgctgatc       600
     gcgcagcaca tgccgcccgg cttcacgcgc tcgttcgcgc agcgcctgaa cgggctgtgc       660
     cggatctcgg tgaaggaggc ggagcacggc gagcgcgtgc tgccggggca cgcgtatatc       720
     gcgcccggcc acgcgcacct gctgctcgcg aggagcggcg cgaactacat cgcgcacctg       780
     tcggacgagc cgcccgtcaa tcgtcatcgc ccgtcggtcg acgtgctgtt ccgctcggcc       840
     gcgcagcatg cgggcaagaa cgcgctcggc gtgatcctga cgggcatggg ccgcgacggc       900
     gcggccgggc tgcttgaaat gaaaaaggcc ggcgcgtata catttgcgca ggacgaggcg       960
     agctgcgtcg tgttcggaat gccgcgcgag gcgatcgcga tgggcggcgt cgacgacgtc      1020
     gcgccccttt ccgacatgag tcgccgtatc atggcgcgcc tcgcgtcgat gggcgatcgc      1080
     gtgcagcgcg tgtga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page