(data stored in SCRATCH9089 zone)

EMBL: CP000124.CHED

CP000124.CHED        Location/Qualifiers
FT   CDS_pept        complement(75055..75759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="BURPS1710b_0072"
FT                   /product="chemotaxis protein CheD"
FT                   /note="identified by match to protein family HMM PF03975"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49527"
FT                   /db_xref="GOA:Q3JY64"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JY64"
FT                   /protein_id="ABA49527.1"
FT                   /translation="MSGLPIATNLYFDAHFHRHGVKLLPNEFYTTREDMVLVTVLGSCV
FT                   AACLHDPIGRIGGMNHFMLPDDGADPSAAASESMRYGAYAMEVLINELIKAGGRRERFE
FT                   AKVFGGAAVLAGMTTINIGDRNADFVRRYLALERIRITAEDLQGVHPRKVAFMPHTGQA
FT                   MVKKLRVQAPDVAAREAALAREAVDPHGERAPRVRPRVELFGTPAPKAQAKPRIELFGM
FT                   RAMQPATRKQEA"
     atgagcgggc tgccgatcgc gaccaacctc tatttcgatg cgcactttca ccgccacggc        60
     gtgaagctgc tgccgaacga gttctacacg acgcgcgagg acatggtgct cgtcacggtg       120
     ctcggctcgt gcgtggccgc gtgcctgcac gatccgatcg ggcggatcgg cgggatgaac       180
     cacttcatgc tgcccgacga cggcgcggac ccgtccgccg ccgcgtccga atcgatgcgc       240
     tacggcgcgt atgcgatgga agtgctgatc aacgagctca tcaaggcggg cggccggcgc       300
     gagcgcttcg aggcgaaggt gttcggcggc gcggccgtgc tcgccgggat gacgacgatc       360
     aacatcggcg atcgcaacgc cgatttcgtg cgccgctatc tggcgctcga gcgcatccgc       420
     attaccgccg aggatctgca gggcgtgcat ccgcgcaagg tcgcgttcat gccgcacacg       480
     gggcaggcga tggtcaagaa gctgcgcgtg caggcgcccg acgtcgccgc gcgggaagcc       540
     gcgctcgcgc gcgaggcggt cgacccgcac ggcgagcgcg cgccccgcgt gcggccgcgt       600
     gtcgagctgt tcggcacgcc cgcgccgaag gcgcaggcga agcctcgcat cgaattgttc       660
     ggtatgcggg ccatgcagcc cgccacaaga aagcaggagg cttga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page