(data stored in SCRATCH9089 zone)

EMBL: CP000124.CHRA

CP000124.CHRA        Location/Qualifiers
FT   CDS_pept        487652..488209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chrA"
FT                   /locus_tag="BURPS1710b_0479"
FT                   /product="possible chromate transport protein similar to
FT                   chrA"
FT                   /note="identified by match to protein family HMM PF02417"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48684"
FT                   /db_xref="GOA:Q3JX10"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX10"
FT                   /protein_id="ABA48684.1"
FT                   /translation="MSVADLFAGFLGLGLISFGGALPFARRALVEERRWLSADEFTDLL
FT                   GLCQFLPGGNVINLSVAVGMRFRGVPGAIAGLLGLVAGPTLVVIALGVLYAKTQQNPAV
FT                   HHLFGGLAAAAAGLLIAMAVKVAKPLRHMRAGACVAVLAFVAIAVLRVPLLPTMLVVTP
FT                   VSIWLASRAPRGANAGAQGVRR"
     gtgagcgtcg ccgatctgtt cgcaggcttt ctgggcctcg ggctgatctc gttcggcggc        60
     gcgctgccgt tcgcgcgccg cgcgctcgtc gaagagcgcc gctggctgag cgccgacgaa       120
     ttcaccgatc tgctcggcct ttgccagttc ctgccgggcg gcaacgtgat caatctgtcc       180
     gtggcggtcg gcatgcggtt tcgcggcgtg ccgggcgcga tcgcgggcct gctcggcctc       240
     gtcgcggggc cgacgctcgt cgtcatcgcg ctcggcgtgc tgtatgcgaa gacgcagcag       300
     aatccggccg tccatcatct gttcggcggc ctcgcggcgg cggcggccgg gctgctgatc       360
     gcgatggcgg tgaaggtggc caagccgctg cgccatatgc gggcgggcgc gtgcgtcgcg       420
     gtgctcgcgt tcgtcgcgat cgcggtgctg cgcgtgccgc tgttgccgac gatgctcgtg       480
     gtgacgcccg tgagcatctg gctcgcgtcg cgcgcgccgc gcggcgcgaa tgcgggcgcg       540
     caaggcgtgc ggcgatga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page