(data stored in SCRATCH9089 zone)

EMBL: CP000124.DKSA

CP000124.DKSA        Location/Qualifiers
FT   CDS_pept        complement(403353..403769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="BURPS1710b_0387"
FT                   /product="DnaK suppressor protein"
FT                   /note="identified by match to protein family HMM PF01258;
FT                   match to protein family HMM TIGR02420"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48600"
FT                   /db_xref="GOA:Q3JXA2"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXA2"
FT                   /protein_id="ABA48600.1"
FT                   /translation="MTKKLLTEAEILKMSDKDYMNEDQLAFFKNRLEQLQAEILRNAGQ
FT                   TTENLRETVIVPDPADRATIEEEHALELRTRDRERKLLKKVQQSLARIESGDYGWCEET
FT                   GEPIGIPRLLARPTATLSLEAQERRELRQKLFGD"
     atgacgaaga aactcttgac cgaagccgaa atcctgaaga tgagcgacaa ggattacatg        60
     aatgaggatc agctcgcctt cttcaaaaat cggctcgaac aattgcaggc ggaaattctc       120
     cgcaatgcgg gccagacgac cgagaatctg cgcgaaacgg tgatcgtgcc ggaccctgcc       180
     gatcgcgcga cgatcgagga agagcacgcg ctcgaactgc gcacgcgcga ccgcgaacgc       240
     aagcttctca agaaggtcca gcaatcgctc gcccgcatcg aatcgggcga ttacggctgg       300
     tgcgaagaga cgggcgagcc gatcggcatc ccccgtctgc tcgcacgtcc gacggctacg       360
     ctgtcgctcg aggcgcagga gcgccgcgag ctgcgtcaga agctgttcgg cgactga          417
//

If you have problems or comments...

PBIL Back to PBIL home page