(data stored in SCRATCH9089 zone)

EMBL: CP000124.DPPC

CP000124.DPPC        Location/Qualifiers
FT   CDS_pept        452623..453540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="BURPS1710b_0439"
FT                   /product="dipeptide transport system permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47935"
FT                   /db_xref="GOA:Q3JX50"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX50"
FT                   /protein_id="ABA47935.1"
FT                   /translation="MSNMQNAMPSQAAPASGRVLALREFWANFSRNRGAVGAGIVVLAL
FT                   VAVALLAPVLAPHSPIEQYRDYVKIPPAWLAGGNWQFVLGTDEAGRDILSRLMYGARMS
FT                   FWIGFVSVVLALIPGVVLGLVAAFFQKWADTPVMRVMDVLLALPSLLLAVAVVAIIGPG
FT                   LTNTMFAIAIVALPAYVRLTRASALGELQKEYVTASRVAGAGTPRLMFSQVLPNCTAPL
FT                   IVQATLGFSSAILDAAALGFLGLGVQPPTAEWGAMLASARDYIDNAWWIVTMPGLSILI
FT                   SVLAINLLGDGLRDALDPKLKRMA"
     atgagcaaca tgcaaaacgc catgccgtcg caggcggcgc ccgcaagcgg gcgcgtgctc        60
     gcgctgcgcg aattctgggc gaatttctcc cgcaaccgcg gcgcggtcgg cgccggcatc       120
     gtcgtgctcg cgctggtggc cgtcgcgctc ctcgcgccgg tgctcgcgcc gcacagcccg       180
     atcgagcagt accgcgacta cgtgaagatc ccgcccgcgt ggctggcggg cggcaactgg       240
     caattcgtgc tcggcaccga cgaagcgggc cgcgacatcc tctcgcggct gatgtacggc       300
     gcgcggatgt cgttctggat cggcttcgtc tcggtcgtgc tcgcgctgat tccgggcgtc       360
     gtgctcgggc tcgtcgccgc gttcttccag aaatgggccg acacgcccgt gatgcgcgtg       420
     atggacgtgc tgctcgcgct gccgtcgctg ctgctcgccg tcgcggtcgt cgcgatcatc       480
     ggcccgggcc tcaccaacac gatgttcgcg atcgcgatcg tcgcgctgcc cgcttacgtg       540
     cgcctcacgc gcgcgtcggc gctcggcgag ctgcagaagg agtacgtgac ggcctcgcgc       600
     gtcgcgggcg cgggcacgcc gcggctgatg ttctcgcagg tgctgccgaa ctgcacggcg       660
     ccgctcatcg tgcaggcgac gctcggcttc tcgtcggcga tcctcgatgc ggcggcgctc       720
     ggctttctcg gcctcggcgt gcagccgccg acggccgagt ggggcgcgat gctcgcgtcc       780
     gcgcgcgact acatcgacaa cgcatggtgg atcgtcacga tgccgggcct gtcgatcctg       840
     atctcggtgc tcgcgatcaa cctgctcggc gacgggctgc gcgacgcgct cgatcccaaa       900
     ctcaaacgga tggcctga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page