(data stored in SCRATCH9089 zone)

EMBL: CP000124.EUTB

CP000124.EUTB        Location/Qualifiers
FT   CDS_pept        complement(149149..150546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutB"
FT                   /locus_tag="BURPS1710b_0141"
FT                   /product="ethanolamine ammonia-lyase, large subunit"
FT                   /EC_number="4.3.1.7"
FT                   /note="identified by match to protein family HMM PF06751"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48271"
FT                   /db_xref="GOA:Q3JXZ6"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXZ6"
FT                   /protein_id="ABA48271.1"
FT                   /translation="MRYTETIGSRTYRFADLKTLLAKASPLRSGDQLAGVAAATEEERV
FT                   AAKMALASAPLTAFLNEAVIPYEDDEVTRLVVDTHSRDAFAEISHLTVGDFRNWLLSPA
FT                   ADAAALERIAPGLTPEMVAAVSKLMRNQDLIAAARKRRVVTRFRNTVGLPGRMSVRLQP
FT                   NHPTDDVKGIAASMLDGLMYGCGDAMIGINPATDSLAAITKLLAMIDAFRERYRVPTQS
FT                   CVLTHVTNTIAAIGKGAPVDLVFQSIAGTEKANASFGISLALLAEAREAALALKRGTVG
FT                   NNLMYFETGQGSALSANAHHGVDQQTCEVRAYAVARAFEPFLVNTVVGFIGPEYLYDGK
FT                   QIIRAGLEDHFCGKLLGVPMGCDICYTNHAQADQDDMDNLLTLLGAAGINFIMGIPGAD
FT                   DVMLNYQSTSFHDQLYVREVLGLRRAPEFEEWLETMEITDAHGALRAASARVPLLAGAN
FT                   DWMGRCA"
     atgcgatata cggagacgat cggttcgcgc acctaccgct tcgcggacct gaaaacgctg        60
     ctcgcgaagg cgagcccttt gcgttccggc gaccagctcg cgggcgtggc ggccgcgacc       120
     gaggaggagc gcgtcgccgc gaagatggcg ctcgcgagcg cgccgctcac cgcgttcctg       180
     aacgaggcgg tgattcccta tgaggacgac gaggtgacgc gtctcgtcgt cgatacgcat       240
     tcgcgcgacg cgttcgccga gatctcgcac ctgacggtcg gcgatttccg caactggctg       300
     ctgtcgccgg cggccgacgc ggccgcgctc gagcggatcg cgccgggcct cacgccggag       360
     atggtcgcgg cggtgtcgaa gctgatgcgc aatcaggacc tgatcgcggc ggcgagaaag       420
     cgccgcgtcg tcacgcgctt ccggaacacg gtggggctgc cggggcggat gtcggtgcgg       480
     ctgcagccga accatccgac cgacgacgtg aagggcatcg ccgcgtcgat gctcgacggg       540
     ctgatgtacg gctgcggcga cgcgatgatc ggcatcaacc cggcgacgga cagcctcgcc       600
     gcgatcacga agctgctcgc gatgatcgac gcgttccgcg agcgctaccg cgtgccgacg       660
     caatcgtgcg tgctcacgca cgtgacgaac acgatcgcgg cgatcggcaa gggcgcgccc       720
     gtcgatctcg tgttccagtc gatcgcgggc acggaaaagg cgaacgcgag cttcggcatt       780
     tcgctcgcgc tgctcgccga ggcgcgcgaa gcggcgctgg cgctcaagcg cggcacggtc       840
     ggcaacaacc tgatgtattt cgagacgggg cagggcagcg cgctgtcggc gaacgcgcat       900
     cacggcgtcg accagcagac ctgcgaggtg cgcgcgtacg cggtcgcacg cgcgttcgag       960
     ccgtttctcg tgaacacggt ggtcggcttc atcggccccg aatacctgta tgacggcaag      1020
     cagatcattc gcgcggggct cgaggatcac ttctgcggca agctgctcgg cgtgccgatg      1080
     ggctgcgaca tctgctacac gaaccacgcg caagccgatc aggacgacat ggacaacctg      1140
     ctcacgctgc tcggcgcggc gggcatcaac ttcatcatgg gcattcccgg cgcggacgac      1200
     gtgatgctga actaccagag cacgtcgttc cacgatcagc tctacgtgcg cgaagtgctc      1260
     ggcctgcgcc gcgcgcccga gttcgaggag tggctggaga cgatggagat cacggacgcg      1320
     catggcgcgc tgcgcgccgc gtcggcgcgc gtgccgctgc tcgccggcgc gaacgactgg      1380
     atggggcgct gcgcatga                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page