(data stored in SCRATCH9089 zone)

EMBL: CP000124.FLGC

CP000124.FLGC        Location/Qualifiers
FT   CDS_pept        473231..473656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="BURPS1710b_0463"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM TIGR01395"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48217"
FT                   /db_xref="GOA:Q3JX25"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX25"
FT                   /protein_id="ABA48217.1"
FT                   /translation="MPSLMNIFDVAGSAMSAQSQRLNVTASNLANADSVTGPDGKPYKA
FT                   KQVVFATAPMGRARTASGQGVGGVQVSKVIDDPSPMKTAYDPSNPAADQNGYVTMPNVD
FT                   PVQEMVNMISASRSYQANVETLNTAKQLMLKTLTIGS"
     atgccttcgt tgatgaacat tttcgacgtc gcgggttccg cgatgtcggc ccagtcgcag        60
     cgcctgaacg tcacggcgtc gaacctcgcg aacgccgaca gcgtgacggg ccccgacggc       120
     aagccctaca aggcgaagca ggtggtgttc gcgaccgcgc cgatgggccg cgcgcgcacc       180
     gcgtccggcc agggtgtcgg cggcgtgcag gtgagcaagg tgatcgacga tccgtcgccg       240
     atgaagacgg cttacgaccc gtcgaacccg gccgccgatc agaacggcta cgtgacgatg       300
     ccgaacgtcg atccggtgca ggagatggtc aacatgattt ccgcgtcgcg ctcgtaccag       360
     gcgaacgtcg agacgctcaa taccgcgaag cagctgatgc tcaagacgct gacgatcggc       420
     agctga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page