(data stored in SCRATCH9089 zone)

EMBL: CP000124.FLHC

CP000124.FLHC        Location/Qualifiers
FT   CDS_pept        complement(84160..84711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhC"
FT                   /locus_tag="BURPS1710b_0081"
FT                   /product="flagellar transcriptional activator FlhC"
FT                   /note="identified by match to protein family HMM PF05280"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49236"
FT                   /db_xref="GOA:Q3JY55"
FT                   /db_xref="InterPro:IPR007944"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY55"
FT                   /protein_id="ABA49236.1"
FT                   /translation="MASKSVVVEVKEITLAIELIELGARLQLLEAETNLSRDRLIKLYK
FT                   ELKGVSPPKGMLPFSTDWFMTWQPNIHSSLFYNIYRFMREHGGCDSIQSIVKAYRLYLE
FT                   HVGLSDDEAVLSLTRAWTLVRFFDSGMLQMTPCTRCGGHFVAHAHDPHHGYVCGLCQPP
FT                   SRAGKTRKAAAQGDQAAIAA"
     atggcatcca agagcgtagt ggtcgaggtc aaggagatca ccctggcgat cgagctgatc        60
     gagctgggtg cgcggctgca actgctcgaa gccgagacga acctgtcgcg cgatcgcctg       120
     atcaagctct acaaggaatt gaagggcgtg tcgccgccga aggggatgct gccgttttcg       180
     accgactggt tcatgacgtg gcagccgaac attcattcgt cgctgttcta taacatctac       240
     cgtttcatgc gcgagcacgg cggctgcgat tcgatccagt cgatcgtcaa ggcgtaccgg       300
     ctgtatctcg agcacgtcgg gctgtcggac gacgaggcgg tgctgagcct cacgcgcgcg       360
     tggacgctcg ttcgcttctt cgattccggc atgctgcaga tgacgccgtg cacccgttgc       420
     ggcggacact tcgtcgcaca cgcacacgat ccgcaccacg gctatgtgtg cggcctttgc       480
     cagccgccgt cgcgcgcggg caagacccgc aaggccgccg cgcagggcga ccaggccgcc       540
     atcgccgcgt ag                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page