(data stored in SCRATCH9089 zone)

EMBL: CP000124.FLID

CP000124.FLID        Location/Qualifiers
FT   CDS_pept        93443..94963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /locus_tag="BURPS1710b_0092"
FT                   /product="flagellar hook-associated protein"
FT                   /note="identified by match to protein family HMM PF02465;
FT                   match to protein family HMM PF07195; match to protein
FT                   family HMM PF07196"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47553"
FT                   /db_xref="GOA:Q3JY44"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY44"
FT                   /protein_id="ABA47553.1"
FT                   /translation="MSTPVTSTTQQQTNSALQQAAQSIISGSTGNSSMDVNSLVTALVN
FT                   AKTAGQSAALSTSIATDQTTLSALGTLKAALTALQAGIGSLSDGTLTQKFTATATGTGL
FT                   TATTGAGAVAGSYSVAVTQIATSQTLSSGAFNATQQLGTGTLTLSVGGKSTSISIDSTN
FT                   NTLSGIAAAINSASNNPGVTATIVTGTDGAHLVLRSASTGAANVINVGVSNLSGDNGLS
FT                   SLAVTSTASTTGGQSTIRSGGSVAWTQSTSAQDAEFTVGGIAASSASNAVSGAIAGVTL
FT                   NLTQAAVGATQTLNVTTDTTAQATAITNVVNLYNTVITTMSSLSSLSGAGTSSQSAGPL
FT                   LGDSTLNMIRNSLARVVGAGVTTGGSTTSLASIGIKFADGSSSSQTDGALTIDTAKLNA
FT                   ALQNSPSTVAALFNSTNGIGAQLNTTIQNYVQTGGVFDTRSNALNQDLKSLAQQQTRLA
FT                   SYASQLTSQYNAQFTALNTLMAQMNSNSNYLTQLFGGSNSSGAMANNK"
     atgtccacgc ccgtcaccag cacgacgcag cagcaaacca actcggcgct gcagcaagca        60
     gcgcagtcga tcatcagcgg ctcgacgggc aattcgtcga tggacgtcaa ctcgctcgtc       120
     accgcgctcg tcaacgcgaa gacggccggc cagagcgcgg cgctgtcgac ttcgatcgcg       180
     accgaccaga cgacgctttc cgcgctcggc acgctgaagg ccgcgctcac cgcgctgcaa       240
     gcggggatcg gctcgctcag cgacggcacg ctgacccaga aattcaccgc cacggcaacg       300
     ggcaccgggc tcaccgcgac gacgggcgcg ggtgcggtgg ccggcagcta ctcggtcgcc       360
     gtcacgcaga tcgccacgtc gcagacgctg tcttccggcg cattcaatgc gacgcagcag       420
     ctcggcaccg gcacgctgac gctgagcgtc ggcggcaaat cgacgtcgat ctcgatcgat       480
     tcgacgaaca acacgctttc cggcatcgcc gccgcgatca actccgcgtc gaacaacccc       540
     ggcgtgacgg cgacgatcgt cacgggcacc gacggcgcgc acctcgtgct gcgctcggca       600
     agcacgggcg cggccaacgt gatcaacgtc ggcgtgagca acctgtccgg cgacaacggg       660
     ctgtcgagcc tcgccgtcac gtcgacggcg agcacgacgg gcggccagtc gacgatccgc       720
     tcgggcggca gcgtcgcatg gacgcaaagc acctccgctc aggacgccga attcacggtg       780
     ggcggcatcg ccgcgtcgag cgcgagcaac gcagtgtcgg gtgcgatcgc cggcgtcacg       840
     ctgaacctca cgcaagccgc cgtcggcgcc acgcagacgc tgaacgtgac caccgacacc       900
     accgcgcagg ccaccgcgat cacgaacgtc gtcaacctgt acaacacggt gatcacgacg       960
     atgtcgtcgc tgtcgtcgct atccggcgcg ggcaccagct cgcaaagcgc ggggccgctc      1020
     ctcggcgact ccacgctcaa catgatccgc aactcgctcg cgcgcgtggt gggcgcgggc      1080
     gtgacgacgg gcggctcgac cacgtcgctc gcgtcgatcg gcatcaagtt cgccgacggc      1140
     tcgtcgtcgt cgcagacgga cggcgcactg accatcgata cggccaagct caacgccgcg      1200
     ctgcaaaaca gcccgtcgac cgtcgccgcg ctcttcaatt cgacgaacgg catcggcgcg      1260
     cagctgaaca ccacgatcca gaactatgtg cagacgggcg gcgtcttcga tacgcgctcg      1320
     aacgcgctga accaggacct gaagagcctc gcgcagcagc agacgcggct cgcgtcgtac      1380
     gcgtcgcaac tcacgtcgca atacaacgcg cagttcaccg cgctcaacac gctgatggcg      1440
     cagatgaaca gcaactcgaa ctacctgacg cagctgttcg gcggcagcaa cagctcgggc      1500
     gcgatggcga acaacaagta a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page