(data stored in SCRATCH9089 zone)

EMBL: CP000124.FLIH

CP000124.FLIH        Location/Qualifiers
FT   CDS_pept        complement(429071..429751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /locus_tag="BURPS1710b_0415"
FT                   /product="Flagellar assembly protein FliH"
FT                   /note="identified by match to protein family HMM PF02108"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47967"
FT                   /db_xref="GOA:Q3JX74"
FT                   /db_xref="InterPro:IPR000563"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX74"
FT                   /protein_id="ABA47967.1"
FT                   /translation="MSDRASASDKPVTAYQRWEMASFDPPPPPPPDDGGAAAAALAAEL
FT                   QRVRDAAHAEGLAAGHVEGQALGYQAGYEQGRAKGFDEGRAEAHTHAAQLAALAASFRD
FT                   ALAGVERDLADDIATLALEIAQQVVRQHVQHDPAALIAAAREVLAAEPALAGAPHLIVN
FT                   PADLPVVEAYLKDELDTLGWSVRTDTSIERGGCRAHASTGEIDATLATRWERVAAALGK
FT                   VSAW"
     atgtctgatc gcgcgagcgc gtcggacaag cccgtcaccg cataccagcg gtgggagatg        60
     gcttcgttcg atcccccgcc gccgccgccg cccgatgacg gcggcgcggc ggcggccgcg       120
     ctcgccgccg aactgcagcg cgtgcgcgac gccgcgcacg cggaagggct cgccgccggc       180
     cacgtcgaag gccaggcgct cggctatcag gccggttacg agcagggacg cgcgaagggc       240
     ttcgacgaag gccgggccga agcgcacacg cacgccgcgc agctcgccgc gctcgccgct       300
     tcgtttcgcg acgcgctcgc gggcgtcgag cgcgatctcg ccgacgacat cgcgacgctc       360
     gcgctcgaga tcgcgcagca ggtcgtgcgc cagcacgtgc agcacgatcc ggccgcgctg       420
     atcgcggccg cgcgcgaagt gctggccgcg gagcccgcgc tcgccggcgc gccgcatctg       480
     atcgtgaatc ccgcggactt gcccgtcgtc gaggcgtatc tgaaggacga gctcgacacg       540
     ctcggctgga gcgtgcgcac cgatacgagc atcgagcgcg gcggctgccg tgcgcacgcg       600
     tcgacgggcg aaatcgacgc gacgctcgcg acccgctggg agcgggtcgc ggccgcgctc       660
     ggcaaggtga gcgcatggtg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page