(data stored in SCRATCH9089 zone)

EMBL: CP000124.GATA

CP000124.GATA        Location/Qualifiers
FT   CDS_pept        383895..385385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="BURPS1710b_0368"
FT                   /product="glutamyl-tRNA amidotransferase subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425;
FT                   match to protein family HMM TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48820"
FT                   /db_xref="GOA:Q3JXC1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXC1"
FT                   /protein_id="ABA48820.1"
FT                   /translation="MHAKSLTELRAALDAKECSAVELAQHYLKRIDAARDLNAFVHVDA
FT                   ELTLAQAKAADAALANGEAGPLAGLPIAHKDVFVTRGWRSTAGSKMLANYASPFDATVV
FT                   ARLSAAGMVTLGKTNMDEFAMGSSNENSAFGPVKNPWDTSAVPGGSSGGSSAAVAARLA
FT                   PAATGTDTGGSIRQPASFAGVTGIKPTYGRVSRYGMIAFASSLDQGGPMARSAADCALL
FT                   LNAMAGFDERDSTSLERADEDYTRHLGKAWAAGGDAGKPLAGLRIGLPAEYFGAGLADD
FT                   VRAAIDAALKTYEALGATLVPVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRYGHRAA
FT                   EYRDLLDMYKKSRAEGFGPEVKRRILVGTYVLSHGYYDAYYLQAQKIRRIIAQDFQEAF
FT                   KSCDVIMGPASPTVAWDIGAKGDDPVQMYLADIYTLSVSLAGLPGMSVPCGFGAGANAK
FT                   RPVGLQIIGNYFDEARMLQVADAFQRATDWHVQEPAGV"
     atgcacgcaa aaagcctgac cgaactgcgc gccgcgctcg acgccaagga atgctcggcc        60
     gtcgagctgg cgcagcacta tctgaaacgg atcgacgccg cgcgcgatct gaacgcgttc       120
     gtccacgtcg acgccgaact cacgctcgcg caggcgaagg ccgccgacgc cgcgctcgcc       180
     aacggcgagg cggggccgct cgccggcctg ccgatcgcgc acaaggacgt gttcgtcacg       240
     cgcggctggc gctccaccgc cggctcgaag atgctcgcga actacgcgag cccgttcgac       300
     gcgaccgtcg tcgcccgcct gtcggcggcc ggcatggtca cgctcggcaa gaccaacatg       360
     gacgagttcg cgatgggttc gtcgaacgag aactccgcgt tcggcccggt gaagaacccg       420
     tgggacacga gcgcggtgcc gggcggcagc tcgggcggca gttccgcggc cgtcgccgcg       480
     cgcctcgcgc ccgccgcgac gggcaccgac acgggcggct cgatccgcca gccggcgtcg       540
     ttcgccggcg tgacgggcat caagccgacc tacgggcgcg tgtcgcgcta cgggatgatc       600
     gcgttcgcgt cgtcgctcga ccagggcggc ccgatggcgc ggagcgcggc cgattgcgcg       660
     ctcctgctga acgcgatggc gggcttcgac gagcgcgatt cgacgagcct cgagcgcgcc       720
     gacgaagact acacgcgcca cctcggcaag gcctgggcgg ccggcggcga cgcgggcaag       780
     ccgctcgcgg gcctgcgcat cggcctgccg gccgaatatt tcggcgcggg cctcgccgac       840
     gacgtgcgcg cggcgatcga cgcggcgctg aagacctacg aggcgctcgg cgcgacgctc       900
     gtgccggtgt cgctgccgaa gacggagctg tcgattcccg tctactatgt gatcgcgccc       960
     gccgaggcgt cgtcgaacct gtcgcgcttc gacggcgtgc gctacggcca ccgtgcggcc      1020
     gaataccgcg atctgctcga catgtacaag aagtcgcgcg ccgagggctt cgggcccgag      1080
     gtgaagcgcc ggattctcgt cggcacgtac gtgctgtcgc acggctacta cgacgcctac      1140
     tacctgcagg cgcagaagat ccgccggatc atcgcgcagg atttccagga agcgttcaaa      1200
     tcctgcgacg tgatcatggg cccggcgtcg cccaccgtcg cgtgggacat cggcgcgaag      1260
     ggcgacgatc ccgtccagat gtatctggcg gatatctata cgctgtcggt gagcctcgcg      1320
     ggcttgcccg gcatgagcgt gccgtgcggc ttcggcgcgg gcgcgaacgc gaagcgcccg      1380
     gtcgggctgc agatcatcgg caactatttc gacgaagccc ggatgctgca ggtcgccgac      1440
     gcgttccagc gcgcgaccga ctggcacgta caagaaccgg caggagtgtg a               1491
//

If you have problems or comments...

PBIL Back to PBIL home page