(data stored in SCRATCH9089 zone)

EMBL: CP000124.GATC

CP000124.GATC        Location/Qualifiers
FT   CDS_pept        383483..383782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="BURPS1710b_0367"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM TIGR00135"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49700"
FT                   /db_xref="GOA:Q3JXC2"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXC2"
FT                   /protein_id="ABA49700.1"
FT                   /translation="MALTLTDVTRIAHLARLEMADADAERTLTQLNEFFGLVEQMQAVD
FT                   TTGIAPLAHPIEQILEVAQRLREDAVTEHVNRDDNQRPAPAVQDGLYLVPKVIE"
     atggctttga ccctgaccga tgtgacacgc atcgcgcacc ttgcgcggct cgaaatggcc        60
     gacgccgacg ccgagcgcac gctgacccag ctcaacgagt tctttggcct cgtcgagcag       120
     atgcaggccg tcgacacgac gggcatcgcg ccgctcgcgc acccgatcga gcagattctg       180
     gaggtcgcgc agcggctgcg cgaagacgcc gtcacggagc acgtgaaccg cgacgacaac       240
     cagcgcccgg cgccggccgt ccaggacggc ctgtacctcg tgccgaaggt gatcgagtaa       300
//

If you have problems or comments...

PBIL Back to PBIL home page