(data stored in SCRATCH9089 zone)

EMBL: CP000124.GCVP

CP000124.GCVP        Location/Qualifiers
FT   CDS_pept        134948..137875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvP"
FT                   /locus_tag="BURPS1710b_0129"
FT                   /product="glycine dehydrogenase"
FT                   /EC_number="1.4.4.2"
FT                   /note="identified by match to protein family HMM PF01212;
FT                   match to protein family HMM PF02347; match to protein
FT                   family HMM TIGR00461"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48266"
FT                   /db_xref="GOA:Q3JY08"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JY08"
FT                   /protein_id="ABA48266.1"
FT                   /translation="MKLEHPDRLMNRTPLSLAALETHDAFAERHIGPDAASQQAMLDTL
FT                   GFATRAALIDAVIPASIRRAETLPLGPFAQPKSEAEALAALRALADKNQVFRSYIGQGY
FT                   YDTHTPAVILRNVLENPAWYTAYTPYQPEISQGRLEALLNFQQMVADLTGLEISNASLL
FT                   DEATAAAEAMTLLQRVGKPQSNVFYVADDVLPQTLEVIKTRAKPIGIEVKSGPAADAAA
FT                   ANAFGVLLQYPGANGDVRDYRALADAIHAAGGHVVVAADILALTVLMPPGEWGADVAVG
FT                   NTQRFGVPMGFGGPHAAYMAVRDEFKRQMPGRLVGVTVDAQGKPALRLALQTREQHIRR
FT                   EKATSNVCTAQALLAIMASMYAVYHGPRGLKTIALRVNRIAALLAAGIRHLGYATVNDT
FT                   FFDTLTIDTGARTAQLHAFAQAKRINLRRAGDTRVGVSVDETTTRADLADLLTIFAQAA
FT                   GATAPDIDALDAGLLPAPALPPSLERTSAYLTHHVFNRHHSETEMLRYLRSLSDKDLAL
FT                   DRSMIPLGSCTMKLNATSEMLPVTWPEFGRIHPFAPAEQTVGYREMIDQLEQMLVAATG
FT                   YAAVSLQPNAGSQGEYAGLLIIHAYHESRGESHRDVCLIPASAHGTNPASAHMAGMKVV
FT                   VVACDAQGNVDIADLKAKADAHSHDLAAIMITYPSTHGVFEQNVREICEIVHAHGGQVY
FT                   VDGANMNAMVGLTAPGQFGGDVSHLNLHKTFCIPHGGGGPGVGPVAVGPHLAKFLPNQR
FT                   STGYARGEDGIGAVSAAPYGSASILPISWMYIAMMGAKNLTAATETAILNANYIAKRLA
FT                   PHYPVLYSGPGGLVAHECILDLRPIKDSSGITVDDVAKRLMDYGFHAPTMSFPVPGTLM
FT                   VEPTESESQEELDRFIAAMIAIRDEIRAVEEGRADREDNPLRHAPHTAAVVTANEWPHA
FT                   YSREQAAFPVASLVANKYWPPVGRADNAYGDRNLFCSCVPVSDYA"
     atgaagctcg aacacccgga ccgcctgatg aaccgcacgc ccctctcgct cgccgcgctc        60
     gaaacgcacg acgcgttcgc cgaacgccat atcggccccg acgccgccag ccagcaggcc       120
     atgctcgaca cgctcggctt cgcgacgcgc gccgcactga tcgacgccgt gatccccgcg       180
     tcgatccgcc gcgccgaaac gctgccgctc ggcccgttcg cgcagccgaa gagcgaagcc       240
     gaagcgctcg ccgcgctgcg cgcgctcgcg gacaagaacc aggtgttccg ctcgtacatc       300
     ggccaaggct actacgacac ccacaccccg gcggtgatcc tgcgcaacgt gctcgaaaac       360
     ccggcgtggt acaccgcgta cacgccgtac caacccgaaa tctcgcaggg ccgcctcgag       420
     gcgctgctga acttccagca gatggtcgcc gacctgacgg gcctcgagat ctccaacgcg       480
     tcgctgctcg acgaagccac ggccgcagcc gaagcgatga cgctgctgca acgcgtcggc       540
     aagccgcagt cgaacgtgtt ctacgtcgcc gacgacgtgc tgccgcaaac gctcgaagtg       600
     atcaagacgc gcgcgaagcc gatcggcatc gaagtgaagt cgggcccggc cgccgacgcc       660
     gccgccgcga acgcgttcgg cgtgctgctg caatatccgg gcgcgaacgg cgacgtgcgc       720
     gactaccgcg cgctcgccga cgcgatccac gccgcgggcg gccacgtcgt cgtcgcggcc       780
     gacatcctcg cgctcaccgt gctcatgccg cccggcgaat ggggcgcgga cgtcgccgtc       840
     ggcaacacgc agcgcttcgg cgtgccgatg ggcttcggcg gcccgcacgc cgcatacatg       900
     gcggtgcgcg acgaattcaa gcggcagatg ccgggccgcc tcgtcggcgt gaccgtcgac       960
     gcgcagggca agcccgcgct gcgcctcgcg ctgcaaacgc gcgagcaaca catccgccgc      1020
     gagaaggcaa cgtcgaacgt ctgcaccgcg caggcgctgc tcgcgatcat ggcgagcatg      1080
     tacgcggtct accacggccc gcgcggcctg aagacgatcg cgctgcgcgt gaaccgcatc      1140
     gcggcgctcc tcgccgcggg catcaggcat ctcggctacg caaccgtcaa cgacacgttc      1200
     ttcgacacgc tgacgatcga caccggcgcg cgcaccgcgc aactccatgc gttcgcgcaa      1260
     gcgaagcgca tcaacctgcg ccgcgcgggc gacacgcgag tcggcgtgtc ggtcgacgaa      1320
     acgacgacgc gcgccgatct cgccgatctg ctcacgattt tcgcgcaggc cgcgggcgcg      1380
     acggcgcccg acatcgacgc actcgacgcc gggctcctcc ccgcgcccgc gctgccgccg      1440
     agcctcgagc gcacgagcgc gtacctgacg caccacgtgt tcaaccgcca ccattcggaa      1500
     acggaaatgc tgcgctacct gcgcagcctg tcggacaagg atctcgcgct cgaccgctcg      1560
     atgatcccgc tcggctcgtg cacgatgaag ctgaacgcga cctccgaaat gctgcccgtc      1620
     acgtggcccg aattcggccg gatccacccg ttcgcgcccg ccgagcagac cgtcggctat      1680
     cgcgagatga tcgaccagct cgagcagatg ctcgtcgcgg caacgggcta cgcggccgtg      1740
     tcgctgcagc cgaacgccgg ctcgcagggc gagtacgcgg gcctgctcat catccatgcg      1800
     tatcacgaat cgcgcggcga aagccatcgc gatgtctgcc tgattccggc gtccgcgcac      1860
     ggcacgaacc cggcgtcggc gcacatggcc ggcatgaagg tcgtggtggt cgcgtgcgac      1920
     gcgcaaggca acgtcgacat cgccgacctg aaggcgaagg ccgacgcgca ttcgcacgac      1980
     ctcgcggcga tcatgatcac gtatccgtcg acgcacggcg tgttcgagca gaacgtgcgc      2040
     gagatctgcg agatcgtcca cgcgcacggc ggccaggtgt acgtcgacgg cgcgaacatg      2100
     aacgcgatgg tcggcctcac cgcgcccggc cagttcggcg gcgacgtgtc gcacttgaac      2160
     ctgcacaaga ccttctgcat cccgcacggc ggcggcggcc cgggcgtcgg cccggtcgcg      2220
     gtcggcccgc acctcgcgaa attcctgccg aaccagcgct cgacgggcta cgcgcgcggc      2280
     gaagacggca tcggcgcggt gtcggcggcg ccttacggct cggcgtcgat cctgccgatc      2340
     tcgtggatgt acatcgcgat gatgggcgcg aagaatttga ccgcggcgac cgaaaccgcg      2400
     atcctcaacg cgaactacat cgcgaagcgc ctcgcgccgc actatccggt gctgtattcg      2460
     ggcccgggcg ggctcgtcgc gcacgaatgc attctcgatc tgcgcccgat caaggattcg      2520
     agcggcatca ccgtcgacga cgtcgccaag cgcctgatgg actacggctt tcacgcaccg      2580
     acgatgagct tcccggtgcc gggcacgctg atggtcgagc cgaccgaatc ggaatcgcag      2640
     gaggaactgg accgcttcat cgcggcgatg atcgcgatcc gcgacgaaat ccgcgcagtc      2700
     gaggaaggcc gcgccgaccg cgaggacaac ccgctgcgtc acgcgccgca cacggcagcc      2760
     gtcgtcaccg cgaacgaatg gccgcacgcg tactcgcgcg aacaggccgc gttcccggtc      2820
     gcgtcgctcg tcgcgaacaa gtactggccg cccgtcggcc gcgcggacaa cgcatatggc      2880
     gaccgcaatc tgttctgctc ctgcgtgccg gtatcggatt acgcctga                   2928
//

If you have problems or comments...

PBIL Back to PBIL home page