(data stored in SCRATCH9089 zone)

EMBL: CP000124.GCVT

CP000124.GCVT        Location/Qualifiers
FT   CDS_pept        132728..133924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="BURPS1710b_0127"
FT                   /product="glycine cleavage system T protein"
FT                   /EC_number="2.1.2.10"
FT                   /note="identified by match to protein family HMM PF01571;
FT                   match to protein family HMM TIGR00528"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50545"
FT                   /db_xref="GOA:Q3JY10"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY10"
FT                   /protein_id="ABA50545.1"
FT                   /translation="MRRRFAELPFCFRARAQGPAALPGTPMTVLKTTPLHAAHRALNAR
FT                   MVDFGGWDMPVNYGSQIEEHQAVRTDAGMFDVSHMCVVDFTGPRVRAFFEHAIANNVAK
FT                   LQTPGKALYSCLLNPQGGVIDDLIVYYFTEEFFRVVVNAGTAEKDIAWFNQLNEQGGFG
FT                   LTIAPRRDFAIVAAQGPNARAKVWDTVPCARAATSELKPFNAAQVAGTPFGDLTVARTG
FT                   YTGEDGFEIIVPATHVEALWNALAERGVRPCGLGARDTLRLEAGMNLYGQDMDESVSPL
FT                   DAGLAWTVDLSAPRAFVGRDALEAHGSRAAFVGLILQKENGRAGGVLRAHQKVATPHGE
FT                   GEITSGTFSPSMQESIAFARVPKDVAIGDTVHVQIRDKQLPARVVKLPFVRNGKVLAA"
     atgcgccggc ggttcgccga gttgccgttt tgttttcgcg cccgggctca aggcccggcc        60
     gccttgcctg ggaccccgat gaccgttctc aaaaccaccc cgcttcatgc cgcgcatcgc       120
     gccctcaacg cccgcatggt cgatttcggc ggctgggaca tgcccgtcaa ctacggctcg       180
     cagatcgaag agcaccaggc ggtgcgcacc gatgccggca tgttcgacgt gtcgcacatg       240
     tgcgtcgtcg atttcacggg cccgcgcgtg cgcgcgttct tcgaacacgc gatcgcgaac       300
     aacgtcgcga agctgcaaac gcccggcaag gcgctctact cgtgcctgct gaacccgcaa       360
     ggcggcgtga tcgacgatct gatcgtctac tacttcaccg aggaattctt ccgcgtcgtc       420
     gtcaacgccg gcactgcgga gaaggacatc gcgtggttca accagctcaa cgagcaaggc       480
     ggcttcggcc tcacgatcgc gccgcgtcgc gacttcgcga tcgtcgccgc ccaaggcccg       540
     aacgcgcgcg cgaaggtgtg ggacaccgtc ccctgcgcgc gcgcagcgac gagcgagctc       600
     aagccgttca acgccgcgca ggtcgcgggc acgccgttcg gcgatctcac cgtcgcgcgc       660
     accggctaca ccggcgagga cggcttcgag atcatcgtcc cggcgacgca cgtggaagcg       720
     ctgtggaacg cgctcgccga gcgcggcgtg cgcccgtgcg ggctcggcgc gcgcgacacg       780
     ctgcggctcg aggccggcat gaacctgtac ggccaggaca tggacgaaag cgtttccccg       840
     ctcgacgcgg gcctcgcgtg gacggtcgac ctgtccgcgc cgcgcgcgtt cgtcggccgc       900
     gacgcgctcg aagcgcacgg ctcgcgcgcg gcattcgtcg gcctgatcct gcagaaggag       960
     aacggccgcg cgggcggcgt gctgcgcgcg caccagaagg tcgccacgcc gcacggcgaa      1020
     ggcgagatca cgagcggcac gttctcgccg tcgatgcagg aatcgatcgc ctttgcgcgc      1080
     gtgccgaagg acgtcgcgat cggcgacacg gtgcacgtgc agatccgcga caagcaactt      1140
     cccgcgcgcg tggtaaaact gccgttcgtg cgcaacggca aggtcctcgc tgcgtaa         1197
//

If you have problems or comments...

PBIL Back to PBIL home page