(data stored in SCRATCH9089 zone)

EMBL: CP000124.GLCD1

CP000124.GLCD1       Location/Qualifiers
FT   CDS_pept        complement(114864..116525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcD1"
FT                   /locus_tag="BURPS1710b_0113"
FT                   /product="hexose oxidase"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF08031"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49675"
FT                   /db_xref="GOA:Q3JY23"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY23"
FT                   /protein_id="ABA49675.1"
FT                   /translation="MSYVYVDGADPRHSTLQKGFNLRWPPTAEAGAAAIYVCRTADDVI
FT                   AASRDALAKGCRITVRSGGHCYEGFVANRLPDDHGRPLAIIDLGLMSGFDIDDRGQIAS
FT                   PFDAAGAPRYRVRVAAGRQNWDGYVGLYKTMGKTLPGGSCYSVGAGGHIVGGGYGLLSR
FT                   LHGLTVDWLTGVDILAPAAGGALGAKHVHSGSTDPADRALFIACRGGGGGNFGVILNYY
FT                   FNALPNAPRTAYWLTLAYDWSHFTQASFGHFLQTYWDWFSRNDANWNAADPALANGGLF
FT                   TLLKLQHRSAGPIVLAIQYTGKDGTVGGPEDAPFIDFVDTMNAAANRLPVVWDRFVAPN
FT                   LPALGHPLAGLRIAHAARSALKMDWLYLTQTINTSGANRRGKYKSAYQIGNFGETEVDA
FT                   LWRYLNGADDPRLSQTLVQIDSYGGCVNANDESANPTSVYQRRSLLKSQYQTYWTNPAD
FT                   DAFHVEWLHDLFSAVHADQGGKPYRDASGRYEGCYINYPDIDMKYLGSDPAQIDPRWLD
FT                   LYYGDKAASLIATKRSVDPSNLFMHEMSIPLTPPLG"
     atgtcctatg tgtacgtcga cggtgccgat ccccgtcatt cgacgcttca aaagggcttc        60
     aacctgcgct ggccgccgac ggccgaggcc ggcgcggcgg cgatctatgt ctgccgcacg       120
     gcggacgacg tgatcgcggc gtcgcgcgac gcgctcgcga aaggttgccg gatcacggtg       180
     cgcagcggcg ggcactgcta tgaggggttc gtcgcgaacc ggctgccgga cgaccacggg       240
     cggccgctcg cgatcatcga tctcggcctg atgtcggggt tcgatatcga tgatcgcggg       300
     cagatcgcgt cgccgttcga tgcggcgggc gcgccgcgct atcgggttcg cgtcgcggcg       360
     ggccgccaga actgggacgg ctatgtcggc ctgtacaaga ccatgggcaa gacgctgccc       420
     ggtggctcgt gctattcggt cggcgcaggc ggccatatcg tcggcggcgg gtatgggctg       480
     ctctcgcgtc tgcacgggct gacggtcgac tggctgacgg gcgtcgatat cctcgcgccc       540
     gccgccggcg gcgcgctcgg cgcgaagcac gtgcattccg gcagcaccga tccggcggat       600
     cgggcgctct tcatcgcatg tcgcggcggg ggcggcggca acttcggcgt gatcctgaac       660
     tactacttca acgcgcttcc caacgcgccg cgtaccgcgt attggctgac gctcgcgtat       720
     gactggtcgc acttcacgca agcgagcttc ggccatttcc tccaaaccta ctgggattgg       780
     ttcagccgca acgacgcgaa ctggaacgcc gcggacccgg cgctcgccaa tggcgggttg       840
     ttcacgcttc tgaaactgca gcatcgctcg gccgggccga tcgtgctcgc gatccagtac       900
     acgggcaagg acggaacggt gggcggcccg gaggatgcgc cgttcatcga tttcgtcgac       960
     acgatgaacg cggcggcgaa tcgtctgccc gtcgtctggg accggttcgt cgcgccgaat      1020
     ctgccggcgc tcggccaccc gctggccggc ctgcgcatcg cgcacgcggc gcggagcgca      1080
     ttgaagatgg actggctgta tctgacgcag acgatcaaca cgtcgggcgc gaaccggcgc      1140
     ggcaagtaca agtccgccta tcagatcggc aatttcggcg agaccgaggt cgacgcgctg      1200
     tggcgatatc tgaacggcgc ggacgatccg cgcctgagcc agacgctcgt gcagatcgat      1260
     tcgtacggcg gctgcgtaaa cgcgaacgac gaaagcgcga atccgacgtc ggtctatcag      1320
     cgccgttcgc tgctgaaatc gcagtaccaa acctactgga cgaatcccgc cgacgacgcc      1380
     ttccacgtcg aatggctgca cgatctgttc tccgcggtgc acgcggatca gggcggcaag      1440
     ccgtaccgcg acgcgagcgg ccgctacgaa ggctgctaca tcaactatcc ggacatcgac      1500
     atgaagtatc tcggcagcga tccggcgcag atcgatccga ggtggctcga tctgtactac      1560
     ggcgacaagg ccgcatcgct gatcgcgacg aagcgctcgg tcgatccgtc gaatctgttc      1620
     atgcacgaga tgtcgattcc gctgacgccg ccgcttggtt ga                         1662
//

If you have problems or comments...

PBIL Back to PBIL home page