(data stored in SCRATCH9089 zone)

EMBL: CP000124.GSHA

CP000124.GSHA        Location/Qualifiers
FT   CDS_pept        337965..339611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="BURPS1710b_0324"
FT                   /product="glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="identified by match to protein family HMM PF04262;
FT                   match to protein family HMM TIGR01434"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50159"
FT                   /db_xref="GOA:Q3JXG3"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXG3"
FT                   /protein_id="ABA50159.1"
FT                   /translation="MPRIAEPALASMPNNMTSRQTDLLQQRLAVLSTSPTREQLPDGLR
FT                   GIEKESLRVTRDGMIAFTPHPRALGSALTHPSLTTDYSEALVELITPAERDAATTLKRL
FT                   DELHRYVYASLGDEMLWTDSMPGLLPADDEIPIADYGTSNIGRLKTVYRRGLAYRYGRT
FT                   MQCIAGIHYNYSLSEEVWRRLHAEEGSTAGIVDYQSERYLALIRNFRRTSWLLMYLFGA
FT                   SPALDAGFLRGRAHKLDTFDAATLYRPHATSLRMSDLGYSNTTAQAALQADYNTLSGYL
FT                   DALSKAVSEPYPPYEAIGTHRDGEWIQINTNVLQIENEFYSTIRPKRVTYSGERPLHAL
FT                   ASRGVQYIEVRCLDIDPFEPTGIALDTARFLDAYLLVCALDESAPLTCDAYRESNANFG
FT                   RVTMEGRKPGLELTRDGAAVPMRAWADEIFAQIEAAGRVLDDIRGDDTHARAIAAQRAK
FT                   LDDPELTSSARVLRAMRENGQSFLEFARAQSAAHAAYFHGRPLDEAATRDARALAERSL
FT                   AEQAELEGKNAGSFDAFVAAYRAYTLNRFSV"
     gtgccgcgga tcgccgagcc cgcacttgca tcaatgccga acaacatgac ttcccgccag        60
     acagacttgt tgcagcaacg ccttgccgtg ttgagcacga gcccgacgcg agagcagctg       120
     cctgacggcc tgcgcggcat cgagaaggaa agcctgcgcg tgacgcgcga cgggatgatc       180
     gcgtttacgc cgcatccgcg cgcgctcggc tcggcgctca cgcatccgtc gctgacgacc       240
     gattattcgg aggcgctcgt cgagctgatc acgcctgcgg agcgcgacgc ggcgacgacg       300
     ctcaagcggc tcgacgagct gcatcgctac gtctacgcgt cgctcggcga cgagatgctg       360
     tggaccgatt cgatgccggg cctgctgccg gccgacgacg aaatcccgat cgcggactac       420
     ggcacgtcga acatcgggcg gctgaagacc gtctaccggc gcggcctcgc gtatcgctac       480
     ggccgcacga tgcagtgcat cgcggggatt cactacaact attcgctgag cgaggaagtg       540
     tggcggcggc tgcacgcgga ggaaggctcg acggcgggca tcgtcgatta ccagtccgag       600
     cgctacctcg cgctgatccg caatttccgc cgcacgagct ggctgctgat gtacctgttc       660
     ggcgcgtcgc ccgcgctcga tgccggcttc ctgcgcggcc gagcgcacaa gctcgacacg       720
     ttcgacgccg cgacgctgta tcgcccgcac gcgacgagcc tgcggatgag cgacctcggc       780
     tactcgaaca cgaccgcgca agccgcgctg caggcggact acaacacgct gtccggctat       840
     ctcgacgcgc tgtcgaaggc ggtcagcgag ccgtatccgc cgtacgaggc gatcggcacg       900
     caccgcgacg gcgagtggat tcagatcaac acgaacgtgc tgcagatcga gaacgagttc       960
     tactcgacga tccggccgaa gcgcgtcacg tattcgggcg agcggccgct gcacgcgctt      1020
     gcgtcgcgcg gcgttcagta catcgaggtg cgctgtctcg acatcgatcc gttcgagccg      1080
     acgggcatcg cgctcgacac cgcgcgcttt ctcgacgcgt acctgctcgt ctgcgcgctc      1140
     gacgagagcg cgccgctcac gtgcgatgcg tatcgcgagt cgaatgcgaa cttcggccgc      1200
     gtgacgatgg aagggcgcaa gccggggctc gagctgacgc gcgacggcgc ggccgtgccg      1260
     atgcgtgcat gggccgacga gatcttcgcg cagatcgaag ccgcgggccg cgtgctcgac      1320
     gacatccgcg gcgacgacac gcatgcgcgc gcgatcgccg cgcagcgcgc gaagctggac      1380
     gatcctgagc tcacgtcttc cgcgcgcgtg ctgcgcgcga tgcgcgagaa cggacagtcg      1440
     ttcctcgagt tcgcacgtgc gcaaagcgcc gcgcatgcgg cgtatttcca tggccgcccg      1500
     ctcgacgaag ccgcgacgcg cgacgcgcgg gcgctcgccg agcgctcgct tgccgagcag      1560
     gccgaactcg aaggcaagaa cgccgggtcg ttcgacgcgt tcgtcgctgc ttaccgcgcc      1620
     tatacgctga accgcttcag cgtgtga                                          1647
//

If you have problems or comments...

PBIL Back to PBIL home page