(data stored in SCRATCH9089 zone)

EMBL: CP000124.GSPI

CP000124.GSPI        Location/Qualifiers
FT   CDS_pept        237879..238283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspI"
FT                   /locus_tag="BURPS1710b_0226"
FT                   /product="general secretory pathway protein I"
FT                   /note="identified by match to protein family HMM PF02501"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47586"
FT                   /db_xref="GOA:Q3JXR1"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXR1"
FT                   /protein_id="ABA47586.1"
FT                   /translation="MRAPAPPRSPARSRGFTMIEVLVALAIIAVALAASIRAVGSMATG
FT                   ASDLHARLLAGWSADNALAQLRLAHAWPDIGMQTFDCSQGNVALTCTQRVSSTPNPVFR
FT                   RVEIAVSMNGRAGVLAQMVTVVANETSRPL"
     atgcgcgcgc ccgccccgcc ccgctctccc gcgcgctcgc gcggcttcac gatgatcgag        60
     gtgctcgtcg cgctcgcgat catcgcggtc gcgctcgcgg cgtcgatccg cgcggtgggc       120
     tcgatggcca cgggcgcgtc cgatctgcac gcgcgcctgc tcgccggctg gagcgcggac       180
     aacgcgctcg cgcaactgcg gctcgcgcac gcgtggcccg acatcggcat gcagacgttc       240
     gactgctcgc agggcaacgt cgcgctcacc tgcacgcagc gcgtgagctc gacgccgaat       300
     cccgtgttca ggcgcgtcga gatcgcggtg tcgatgaacg gacgggccgg cgtgctcgcg       360
     cagatggtga cggtggtcgc gaatgaaacc agccgtccgc tctga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page