(data stored in SCRATCH9089 zone)

EMBL: CP000124.GSPK

CP000124.GSPK        Location/Qualifiers
FT   CDS_pept        238991..240241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspK"
FT                   /locus_tag="BURPS1710b_0228"
FT                   /product="General secretion pathway protein K"
FT                   /note="identified by match to protein family HMM PF03934"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49596"
FT                   /db_xref="GOA:Q3JXQ9"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ9"
FT                   /protein_id="ABA49596.1"
FT                   /translation="MRAFALLARFASPGRPRAALGPHAPDAVQPAPARSPRAPHGGSAV
FT                   ADVRVCPPARRPGAPVHRERGVAIINALLVVALSAILVSGMLWRQQVQVRRIENQRLLA
FT                   QAQWVARGALDWTRMVLRSEGDTAPGITYLGGIWAVPIAKTKLSDFLGRIGVTDSAEGS
FT                   DTYLSGSIEDAQAKFNLRNLVSSPAPGALQLNAAQVQTFQRLLATLGLDQQLAKIVARR
FT                   VRAGLKQSATRFQAAQLPGAASGVPVPLPDGGTESGGNFTDEPGIAGGEGRGPAPLMMT
FT                   SVDSLLDVEGFTPEMVERLRPFVTVLPTVTPVNLNTAPAEVIAALVPGMSVSSAQALVS
FT                   RRETVFFRNVGDVQLALRGSGAPNVNLDSSQIDVTSSYFIVHGRIEHDRAVVDRTSLVY
FT                   RDPTTHTTRIVRIRDQL"
     atgcgcgcct tcgccctcct cgctcgcttc gcctcgcccg gccgcccgcg cgcggcgctc        60
     ggtccgcatg cgccggacgc cgtgcagccg gcgccggcgc gttcgccgcg cgcgcctcac       120
     ggcggcagcg ccgtggccga tgtccgcgtt tgcccgcccg cgcggcgccc gggagcgccc       180
     gtgcaccgcg agcgcggcgt cgcgatcatc aacgcgctgc tcgtcgtcgc gctgtcggcg       240
     atcctcgtct ccgggatgct gtggcgccag caggtgcagg tgcgccggat cgagaaccag       300
     cgcctgctcg cgcaggcgca gtgggtcgcg cgcggcgcgc tcgactggac gcggatggtg       360
     ctgcgctccg agggcgacac ggcgcccggc atcacctatc tcggcgggat ctgggcggtg       420
     ccgatcgcga agacgaagct gtcggatttt ctcggccgca tcggtgtgac cgattcggcc       480
     gaaggctcgg acacctatct gtccggctcg atcgaggatg cacaggcgaa gttcaatctg       540
     cgcaacctcg tgtcgtcgcc cgcgccgggc gcgctgcaac tgaacgccgc gcaggtgcag       600
     acgtttcagc ggctgctcgc gacgctcggg ctcgaccagc agctcgcgaa gatcgtcgcg       660
     cgccgcgtgc gcgcggggct caagcagtcg gcgacgcgct tccaggcggc ccagttgccg       720
     ggcgccgcga gcggcgtgcc cgttccgctg ccggacggcg gcaccgagag cggcggcaat       780
     ttcaccgacg agccgggcat cgcgggcggc gaaggccgcg ggcccgcgcc gctgatgatg       840
     acgagcgtcg attcgctgct cgacgtcgag ggtttcacgc cggagatggt cgagcggctg       900
     cgcccgttcg tcaccgtgct gccgacggtg acgcccgtca atctgaacac cgcgcccgcc       960
     gaggtgatcg cggcgctcgt gccggggatg tcggtgtcgt ccgcgcaggc gctcgtgtcg      1020
     cggcgcgaga ccgtgttttt ccgcaacgtc ggcgacgtgc agctcgcgct gcgcggctcc      1080
     ggcgcgccga acgtgaacct cgattcgagt cagatcgacg tcacgtccag ctatttcatc      1140
     gtgcatggcc gaatcgagca cgaccgggca gtcgtggatc gcacgtcgct cgtgtatcgt      1200
     gatccgacca cgcatacgac gcgcatcgtg cgcatccgcg atcagctata a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page