(data stored in SCRATCH9089 zone)

EMBL: CP000124.GSPL

CP000124.GSPL        Location/Qualifiers
FT   CDS_pept        240308..241696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspL"
FT                   /locus_tag="BURPS1710b_0229"
FT                   /product="general secretion pathway protein L"
FT                   /note="identified by match to protein family HMM PF05134;
FT                   match to protein family HMM TIGR01709"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50481"
FT                   /db_xref="GOA:Q3JXQ8"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ8"
FT                   /protein_id="ABA50481.1"
FT                   /translation="MPLQEWQWPELPFALVDKSGHTQRAGRAALALLPQAATTVLIVAA
FT                   RDLLMLEQALPPLKGPRLKQALPNIIEDQLIQDPQGCHIAVDPAALDGGRRVLAVIDRA
FT                   WFKFIVDAFTAAGHRHLRAVPVTRCLPPATRRDAAAAAETEAVADVALDRPAEHAAAAD
FT                   APGSGHAGATANAPAPAESIVAVALGLAATERAPSLAEEPAALLPQAPSAPRVELALAR
FT                   GALGEGFAAPVSSAVATLEALANGTPLELYELGEPGAEPQLASVRPLDDKRLLPGAAIW
FT                   PFDALVRRALDSRFDLCQFEFEFAPWRFDRATFMRLRLPLALAATTLAIAVIGANAHWW
FT                   KLSRERDALAAQITETLLSTFPKTTTVLDPAAQMTRQLDRLRIAAGELSPNDFLSLASG
FT                   LARSLGPLPPNGIASLDYHDRRLDVGFKPETKVDPDFAQRLARNGLTGEIDSSTGKWTI
FT                   RSRS"
     gtgccgttgc aggaatggca atggcccgag ctgccgttcg cgctcgtcga caagagcggc        60
     cacacgcagc gcgcgggccg cgcggcgctc gcgctgctgc ctcaggcggc gacgacggtg       120
     cttatcgtcg ccgcgcgcga cctgctgatg ctcgagcagg cgctgccgcc gctgaaaggg       180
     ccgaggctga agcaggcgct gccgaacatc atcgaggatc aactgatcca ggatccgcag       240
     ggctgccaca tcgcggtcga tccggcggcg ctcgacggcg ggcgccgcgt gctcgcggtg       300
     atcgaccgcg cgtggttcaa gttcatcgtc gacgccttca ccgcggccgg gcatcgccat       360
     ctgcgcgcgg tgcccgtcac gcgctgcctg ccgcccgcga cgcgccgcga tgcggccgcg       420
     gcggccgaga ccgaggctgt cgccgacgtc gcgctcgatc ggccggcgga gcacgccgcc       480
     gcggccgacg cgccgggcag cggccacgcg ggcgcgaccg cgaacgcccc ggcgccggcc       540
     gagtcgatcg tcgcggtcgc gctcggcctc gccgcgacgg agcgcgcgcc gtcgctcgcc       600
     gaggaaccgg cggcgctgct gccgcaggcg ccgagcgcgc cgcgcgtcga gctcgcgctc       660
     gcgcgcggcg cgctcggcga aggcttcgcc gcgccggtgt cgagcgcggt ggcgacgctc       720
     gaagcgctcg cgaacggcac gccgctcgag ctctacgagc tcggcgagcc gggtgccgag       780
     ccgcagctcg cttcggtgcg cccgctcgac gacaagcgct tgctgccggg cgccgcgatc       840
     tggccgttcg acgcgctcgt gcgccgtgcg ctcgattcgc gcttcgacct ctgccagttc       900
     gaattcgagt tcgcgccgtg gcgcttcgac cgcgcgacgt tcatgcgcct gcgcttgccg       960
     ctcgcgctcg cggcgacgac gctcgccatc gcggtgatcg gcgcgaacgc gcactggtgg      1020
     aagctctcgc gcgagcgcga cgcactcgcc gcgcagatca ccgagacgct gctctcgacg      1080
     tttccgaaga cgacgacggt gctcgatccg gccgcgcaga tgacgcgcca gctcgaccgg      1140
     ctgcggatcg ccgcgggcga gctgtcgccg aacgatttcc tgtcgctcgc gagcggcctt      1200
     gcgcgctcgc tcggcccgct gccgccgaac ggcatcgcat cgctcgatta tcacgatcgc      1260
     cggctcgacg tcggcttcaa gcccgagacc aaggtcgacc ccgatttcgc gcagcgcctc      1320
     gcgcgcaacg gcctcacggg cgagatcgac agcagcacgg gcaaatggac cattcggagc      1380
     cgatcatga                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page