(data stored in SCRATCH9089 zone)

EMBL: CP000124.GSPM

CP000124.GSPM        Location/Qualifiers
FT   CDS_pept        241693..242199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspM"
FT                   /locus_tag="BURPS1710b_0230"
FT                   /product="general secretory pathway protein M"
FT                   /note="identified by match to protein family HMM PF04612"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48585"
FT                   /db_xref="GOA:Q3JXQ7"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ7"
FT                   /protein_id="ABA48585.1"
FT                   /translation="MKTTEFNEALSQFWEARTAREKLLLGWGGAVLALAIAYSVLWSPA
FT                   QEGRARIQRELPTMRHELAEMTAQANEARSLAGAAQGVAPTGVALKDALAASLSDHGLA
FT                   AAAPQVVGGGVQIQLKNASFPAWTQWLDDVRRQFKAQVVEAHVSALKEDGQVDLTAVLQ
FT                   PASVK"
     atgaaaacga cggagttcaa cgaagcactg agccagttct gggaggcccg caccgcacgc        60
     gaaaagttgc tgctcggctg gggcggcgcg gtgctcgcgc tcgcgatcgc gtattcggtg       120
     ttatggtcgc ccgcgcagga gggccgcgcg cggatccagc gcgagctgcc gacgatgcgc       180
     cacgagctcg ccgaaatgac cgcgcaggcg aacgaggcgc gctcgctcgc gggcgccgcg       240
     cagggcgtcg cgccgacggg cgtcgcgttg aaggatgcgc tcgccgcgtc gctgtccgat       300
     cacgggctcg cggcggcggc gccgcaggtg gtcggcggcg gcgtgcagat ccagttgaag       360
     aacgcgtcgt tccccgcgtg gacgcagtgg ctcgacgacg tgcgccgcca gttcaaggcg       420
     caagtcgtcg aagcgcacgt gagcgcgctg aaggaggacg gccaggtcga tctgacggcg       480
     gtgctgcagc cggcgtcggt caagtga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page