(data stored in SCRATCH9089 zone)

EMBL: CP000124.GSPN

CP000124.GSPN        Location/Qualifiers
FT   CDS_pept        242238..243029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspN"
FT                   /locus_tag="BURPS1710b_0231"
FT                   /product="general secretory pathway protein N"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49641"
FT                   /db_xref="GOA:Q3JXQ6"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ6"
FT                   /protein_id="ABA49641.1"
FT                   /translation="MPMTWPMRVRRVAPWILIGGVAILVTLVALLPASWVTPQFGRATG
FT                   GHVNLVDPDGSLWRGSATLLLAPGADRSASTLLPGRVEWRTQFWPLFAGRVRMRLRQTD
FT                   AMPDGVTLDATLRGAVLSAGSMAVPASLLAGLGTPFNTLDLQGDVRLDWTDWRLFGKDA
FT                   FGQLTVTITDMSSRVSRVKPLGSYRAVLEARGANSTLDLSTSKGPLMMSGQGNFGATGA
FT                   SFRGTASAEPEQRDNLAGLLNLLGHPIGNGAVSLIYGDAAR"
     atgccgatga cctggccgat gcgcgttcgg cgcgtcgcgc cgtggattct catcggcggt        60
     gtcgcgattc tcgtcacgct cgtcgcgctg ctgcccgcgt cctgggtaac gccgcagttt       120
     gggcgcgcga cgggcggcca cgtcaatctc gtcgatcccg acggctcgct ctggcgcggc       180
     tcggcgacgc tgctgctcgc gcccggcgcg gaccgcagcg cgtcgacgct gttgcccggc       240
     cgcgtcgaat ggcgcacgca gttctggccg ctgttcgccg gacgcgtgcg gatgcggctg       300
     cgccagacgg acgcgatgcc cgacggcgtc acgctcgatg cgacgctgcg cggcgcggtg       360
     ctgtcggcgg gctcgatggc ggtgccggcg tcgctgctcg cggggctcgg cacgccgttc       420
     aacacgctcg acctgcaagg cgacgtgcgg ctcgactgga ccgactggcg gctcttcggc       480
     aaggacgcgt tcggacagct cacggtgacg atcaccgaca tgagctcgcg cgtgtcgcgc       540
     gtgaaaccgc tcggctcgta ccgtgcggtg ctcgaggcgc gcggcgcgaa ttcgacgctc       600
     gatctgtcga cgtcgaaagg gccgctgatg atgtcggggc aagggaattt cggcgcgacg       660
     ggcgcgtcgt ttcgcggcac cgcgagcgcc gagcccgaac agcgcgacaa tctcgcgggc       720
     ttgctgaacc tgctcggcca tccgatcggc aacggcgcgg tatcgctgat ttacggcgac       780
     gcggcgcgct ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page