(data stored in SCRATCH9089 zone)

EMBL: CP000124.HPCH

CP000124.HPCH        Location/Qualifiers
FT   CDS_pept        374786..375571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpcH"
FT                   /locus_tag="BURPS1710b_0359"
FT                   /product="HpcH/HpaI aldolase family protein"
FT                   /EC_number="4.1.2.-"
FT                   /note="identified by match to protein family HMM PF03328"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50968"
FT                   /db_xref="GOA:Q3JXD0"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXD0"
FT                   /protein_id="ABA50968.1"
FT                   /translation="MSTLTHSLKARLRDGDEPLFGLWLTLASEAATEALAHAGFDWLCI
FT                   DMEHAPNDSRDVAAQLRALAAAHLPSEPVVRVPAREPWFVKRALDAGARTLMFPGVETA
FT                   DEAAHAVRLTRFQAPDAPDGLRGVAGIVRAAAYGMRRDYVQTANAQIATIVQIESARGV
FT                   DEAERIAATPGVDCVFVGPADLSASLGHLGDTKHPDVAAALEHVLAAGRRAGVPVGIFA
FT                   ADTAGARQSLEAGFRVVALSADVVWLLRATRQALQEVRG"
     atgagcacgc tcacccattc cctgaaagca cgtttgcgcg acggcgacga gccgctgttc        60
     ggcctatggc tgacgctcgc gagcgaggcg gcgaccgagg cgctcgcgca cgccggtttc       120
     gactggctgt gcatcgacat ggagcacgcg ccgaacgaca gccgcgacgt cgccgcgcaa       180
     ctgcgcgcgc tcgcggccgc gcatctgccg agcgagcccg tcgtgcgggt gccggcgcgc       240
     gagccgtggt tcgtcaagcg ggcgctcgac gcgggtgcgc gcacgctgat gttcccgggc       300
     gtcgagacgg ccgacgaggc cgcgcatgcg gtgcggctca cgcgctttca ggcgcccgat       360
     gcgccggacg ggctgcgcgg cgttgcgggc atcgtgcgcg cggccgctta tgggatgcgg       420
     cgcgactacg tgcagacggc gaacgcgcag atcgcgacga tcgtgcagat cgaatcggcg       480
     cgcggcgtcg acgaagccga gcggatcgcg gcgacgccgg gcgtcgattg cgtattcgtc       540
     gggcccgccg acctgtccgc gagcctcggg catctcggtg acacgaagca tccggacgtc       600
     gcggccgcgc tcgagcacgt gctcgcggcc gggcggcgcg ccggcgtgcc ggtcggcatc       660
     ttcgccgcgg atacggccgg cgcgcgccag tctctcgaag ccggattccg cgtggtcgcg       720
     ttgtccgcgg acgtcgtgtg gctgctgcgc gcgacgcgac aggcgctgca ggaggtgcgg       780
     ggatga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page