(data stored in SCRATCH9089 zone)

EMBL: CP000124.HTPX

CP000124.HTPX        Location/Qualifiers
FT   CDS_pept        365529..366386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="BURPS1710b_0349"
FT                   /product="HtpX-2 endopeptidase"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47921"
FT                   /db_xref="GOA:Q3JXD9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXD9"
FT                   /protein_id="ABA47921.1"
FT                   /translation="MFNWVKTAMLMAAITALFIVIGGMIGGSRGMTIALLIALGMNFFS
FT                   YWFSDKMVLRMYNAQEVDEATAPQFYRMVRELATRANLPMPRVYLIDENQPNAFATGRN
FT                   PEHAAVAATTGILRVLSEREMRGVMAHELAHVKHRDILISTISATMAGAISALANFAMF
FT                   FGGRDENGRPANPIAGIAVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQALASA
FT                   LDKIHRYASGIPFQTAEEHPATAQMMIMNPLSGGGLQNLFSTHPATEERIARLMDMART
FT                   GRFD"
     atgttcaatt gggtcaaaac ggcgatgctg atggccgcga tcacggccct gttcatcgtg        60
     atcggcggca tgatcggcgg atcgcgcggg atgacgatcg cgttgctgat cgcgctcggg       120
     atgaatttct tctcatactg gttctccgac aagatggtgc tgcgcatgta caacgcgcag       180
     gaagtcgacg aggccacggc gccgcagttc tatcggatgg tgcgcgaact tgcgacgcgc       240
     gcgaacttgc cgatgccgcg cgtttatctg atcgatgaga accagccgaa cgcgtttgcg       300
     accggccgca atcccgagca cgcggccgtc gccgcgacga cgggcatcct gcgtgtgctg       360
     tccgagcgcg agatgcgggg cgtgatggcg cacgagcttg cgcacgtgaa gcatcgcgac       420
     atcctgatct cgacgatttc ggcgacgatg gcgggcgcga tctcggcgct cgcgaatttc       480
     gcgatgttct tcggcgggcg cgacgagaat ggccggccgg caaatccgat cgcgggcatc       540
     gcggtcgcgc tgctggcgcc gatcgcgggc gcgctgattc agatggcgat ttcgcgtgcg       600
     cgcgaattcg aggcggaccg cggcggcgcg cagatctcgg gcgatccgca ggcgcttgcc       660
     tcggcgctcg acaagatcca ccgctatgcg tcgggcattc cgtttcagac agccgaggag       720
     catccggcca ccgcgcagat gatgatcatg aatccgctgt cgggcggtgg gctgcagaat       780
     ctgttctcga cgcaccccgc caccgaggag cggatcgcgc ggctgatgga catggcgcgc       840
     accggccgct tcgactga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page