(data stored in SCRATCH9089 zone)

EMBL: CP000124.ILVG

CP000124.ILVG        Location/Qualifiers
FT   CDS_pept        142011..143714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="BURPS1710b_0133"
FT                   /product="acetolactate synthase isozyme II large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48852"
FT                   /db_xref="GOA:Q3JY04"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY04"
FT                   /protein_id="ABA48852.1"
FT                   /translation="MSISPDREQRATTGARLLVDALLANHVERVFCVPGESFLAVLDSL
FT                   ADETERIRTIVCRHEAAAANMAEAVGKLTGRPGIAFATRGPGATHASIGVHTAFQDSTP
FT                   MILFIGQCAREHLDREAFQEIDYRRMFGQLAKWVAQIDDPRRIPEYLSHAFHVAMSGRP
FT                   GPVVLALPEDVLSEPCAAQPVAPAARRVAAAPSAAQMSELRERLARAQRPLVLAGGSGW
FT                   TPDACADLRTFVERWQLPIACAFRYQDTFDNAHPQYAGDVGLGVNPELARRIREADLLF
FT                   ALGPRLGEATTGGYTLIDIPRPKQVLIHVHQGADELGRVYAADLPIASGMPEIAAQLAA
FT                   LEPPASLAWAGSAADAHRAYLDWQAPRPMPGEVQLGDVMRQLRERLPHDAIVTNGAGNY
FT                   AAWLHRHFAYRHFRSQLAPTSGAMGYGVPAALAAKSLYPQRTVVALAGDGCFMMAGNEL
FT                   ATAIQYGLAIIVLVVNNGHFGTIRMHQERHYPGRVHGTGLTNPDFAAYARAFGAHGETV
FT                   ERTADFLPALERALASGAPALIEIRVPQDACTPAATLEQVREQGLRARRA"
     atgtcgattt ccccggaccg cgagcagcgc gccaccaccg gcgcgcgcct gctcgtcgac        60
     gccctgctcg cgaatcacgt cgagcgcgtg ttctgcgtgc ccggcgagag cttcctcgcc       120
     gtgcttgatt ccctcgccga cgaaaccgaa cgcatccgca ccatcgtctg ccggcacgaa       180
     gccgcggccg cgaacatggc ggaagccgtc ggcaagctga ccggccggcc cggcatcgcg       240
     ttcgccacgc gcgggcccgg cgcgacgcac gcgtcgatcg gcgtgcacac cgcgtttcag       300
     gattcgacgc cgatgatcct cttcatcggc cagtgcgcgc gcgagcatct cgatcgggaa       360
     gcgttccagg agatcgacta tcggcgcatg ttcggccagc tcgcgaaatg ggttgcgcag       420
     atcgacgatc cgcgccgcat tcccgaatac ctgagccatg cgttccacgt cgcgatgtcg       480
     ggccggccgg gccccgtcgt gctcgcgctg cccgaggacg tgctgtccga gccgtgcgcg       540
     gcgcagcccg tcgcgcccgc ggccaggcgc gtcgccgccg cgccgtccgc cgcgcagatg       600
     agcgagctgc gcgagcggct cgcgcgtgcg cagcgcccgc tcgtgctcgc gggcggcagc       660
     ggctggacgc ccgacgcgtg cgcggatctg cgcacgttcg tcgaacgctg gcagttgccg       720
     atcgcgtgcg cattccgcta tcaggacacg ttcgacaacg cgcatccgca gtacgcgggc       780
     gacgtcggcc tcggcgtgaa ccccgagctc gcgcgccgca tccgcgaagc ggacctgctg       840
     ttcgcgctcg gcccgcgcct cggcgaagcg acgacgggcg gctatacgct gatcgacatt       900
     ccgaggccga agcaggtgct cattcatgtg catcaaggcg cggacgagct ggggcgcgtc       960
     tacgcggccg atctgccgat cgcctccggc atgcccgaga tcgccgcgca gctcgccgcg      1020
     ctcgaaccgc ccgcgtcgct cgcgtgggcg ggcagcgccg ccgacgcgca tcgcgcctac      1080
     ctcgactggc aagcgccccg gccgatgccg ggcgaggtgc agctcggcga cgtgatgcgg      1140
     caattgcgcg agcggctgcc gcacgacgcg atcgtgacga acggcgccgg caactacgcg      1200
     gcgtggctgc accgccattt cgcttatcgg cacttccgct cgcagctcgc gccgacgagc      1260
     ggcgcgatgg gctacggcgt gccggccgcg ctcgccgcga agtcgctgta tccgcagcgc      1320
     acggtggtcg cgctcgcggg cgacggctgc ttcatgatgg ccggcaacga actcgcgacg      1380
     gcgatccagt acgggctcgc gatcatcgtg ctcgtcgtga acaacggcca cttcggcacg      1440
     atccgcatgc atcaggaacg ccattacccc ggccgcgtgc acggcaccgg gctcacgaac      1500
     ccggatttcg ccgcctatgc gcgcgcgttc ggcgcgcacg gcgagacggt cgagcgcacc      1560
     gccgatttcc tgcccgcgct cgaacgcgcg ctcgcgagcg gcgcgcccgc gctgatcgag      1620
     atccgcgtgc cgcaagacgc gtgcacgccc gccgcgacgc tcgagcaggt gcgcgagcaa      1680
     gggctgcgcg cgcgtcgcgc ttga                                             1704
//

If you have problems or comments...

PBIL Back to PBIL home page