(data stored in SCRATCH9089 zone)

EMBL: CP000124.LIVF

CP000124.LIVF        Location/Qualifiers
FT   CDS_pept        complement(195848..196603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="BURPS1710b_0191"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47652"
FT                   /db_xref="GOA:Q3JXU6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXU6"
FT                   /protein_id="ABA47652.1"
FT                   /translation="MDREAKPVLAVQNLSVRYGKVEALHRAALTVGAGQIVTVIGPNGA
FT                   GKSTLLNAVMGALPTNGHAAGTVLYRGDDVDALPVEQRVALGMCLVPEKRELFGTMSVE
FT                   DNLVLGAYRRKMAGDASFLDQLEPVFSLFPRLKERRKQAAGTLSGGERQMLAVGRALMG
FT                   KPDLLMLDEPSLGLAPLIVKEIFHIISALRGTGVAMLLIEQNARAALQISDYGYVLETG
FT                   EIALEGPAGELAQNPQVIETYLGLARKAV"
     atggatcgag aggcgaagcc ggtgttggcg gtacagaatc tgtcggtgcg ctacggcaag        60
     gtcgaggcgt tgcatcgtgc ggccctgacg gtcggagcag ggcagatcgt cacagtgatt       120
     gggccgaacg gggcgggaaa gtcgacgctg ctcaatgcag tgatgggcgc gttgccgacg       180
     aatggccatg ctgccggtac ggttctttac cgcggcgacg atgtggatgc attgccggtc       240
     gagcagcgtg tcgcgctcgg tatgtgcctc gtgccggaaa agcgtgagct attcggcacg       300
     atgtcggtag aggacaattt ggtgttaggc gcataccggc gaaagatggc cggcgacgcg       360
     agcttcctgg atcagctcga gccggttttt tcgctgtttc cgaggttgaa ggagcgacgc       420
     aagcaagcgg ccggcacgct ttcgggtggc gagcggcaga tgctggctgt cgggcgcgcg       480
     ctgatgggca aacccgattt gctgatgctc gacgagccga gccttgggct tgcaccgctg       540
     atcgtgaagg agattttcca tatcatcagc gcgctgcgcg ggaccggcgt tgcgatgctg       600
     ttgatcgagc agaacgcgcg ggcagcattg cagatatcgg attacgggta tgtcctcgag       660
     accggtgaga ttgctctgga gggcccggcg ggcgaactcg cgcagaatcc gcaagtgatc       720
     gaaacctacc tggggctcgc aagaaaggcg gtctag                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page