(data stored in SCRATCH9089 zone)

EMBL: CP000124.MARR

CP000124.MARR        Location/Qualifiers
FT   CDS_pept        245492..246025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="marR"
FT                   /locus_tag="BURPS1710b_0234"
FT                   /product="MarR family protein"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47940"
FT                   /db_xref="GOA:Q3JXQ3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ3"
FT                   /protein_id="ABA47940.1"
FT                   /translation="MHCCGSCNRPDSLTMSGLYDPEHIELESSLGYYLTKARQALVERL
FT                   DRALGPLELTAQQISVILLLARGYARTPFELSRKLSYDSGSMTRMLDRLEKKGFVVRAR
FT                   SESDRRVIELALTERGAHAARALPALIATELNAQLEGFSADELALLTDLLRRFIANAPG
FT                   AADAACAEPPPDQR"
     atgcactgtt gcggctcgtg caatcgaccg gacagcttga cgatgagcgg cctttacgac        60
     ccggagcaca tcgagctcga atcgagcctc ggctattacc tgacgaaggc gcggcaggcg       120
     ctcgtcgagc ggctcgaccg cgcgctcggc ccgctcgaac tgaccgcgca gcagatcagc       180
     gtgatcctgt tgctcgcgcg cggctatgcg cgtacgccgt tcgagctgtc gcgcaagctg       240
     tcatacgaca gcggttcgat gacgcgcatg ctcgaccggc tcgagaagaa gggcttcgtc       300
     gtgcgcgcgc gcagcgaatc ggaccgccgc gtgatcgagc tcgcgctgac cgagcgcggc       360
     gcgcacgcgg cgcgggcgct gcctgcgctg atcgcgaccg agctgaacgc gcagctcgag       420
     ggtttttcgg ccgatgagct cgcgctgctg acggacctgc tgcggcgctt catcgcgaat       480
     gcgccgggcg cggccgacgc cgcgtgcgcc gaaccgccgc cggatcagcg ctga             534
//

If you have problems or comments...

PBIL Back to PBIL home page