(data stored in SCRATCH9089 zone)

EMBL: CP000124.METX

CP000124.METX        Location/Qualifiers
FT   CDS_pept        complement(394503..395648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="BURPS1710b_0377"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM TIGR01392"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50518"
FT                   /db_xref="GOA:Q3JXB2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXB2"
FT                   /protein_id="ABA50518.1"
FT                   /translation="MESIGVVAPHTMHFAEPLRLQSGSVLGNYQLVVETYGELNAVRSN
FT                   AVLVCHALNASHHVAGVYADDPRSTGWWDNMVGPGKPLDTNRFFVIGVNNLGSCFGSTG
FT                   PMNIDPATGTPYGARFPVVTVEDWVHAQARVADALGIERFAAVMGGSLGGMQALAWSLL
FT                   YPERVAHCIDIASTPKLSAQNIAFNEVARSAILSDPDFHGGDYYAHGVKPRRGLRVARM
FT                   IGHITYLSDDDMAEKFGRALRRADGALDAYNFNFDVEFEVESYLRYQGDKFADYFDANT
FT                   YLLITRALDYFDPAKAFNGDLSAALAHTKAKYLIASFMTDWRFAPARSREIVKALLDNR
FT                   RSVSYAEIDAPHGHDAFLLDDARYHNLVRAYYERIAEEVGA"
     atggaatcga tcggcgtcgt cgctccacac accatgcatt tcgccgaacc gctgcgcctg        60
     caaagcggca gcgtgctcgg caactatcag ctcgtcgtcg agacctacgg cgagctcaac       120
     gccgtgcgct cgaacgcggt gctcgtctgt cacgcgctca acgcgtcgca tcacgtcgcg       180
     ggcgtctacg cggacgatcc gcgcagcacc ggctggtggg acaacatggt cgggcccggc       240
     aagccgctcg acacgaaccg cttcttcgtg atcggcgtga acaatctcgg ctcgtgtttc       300
     ggctcgacgg ggccgatgaa catcgatccc gcaacgggca cgccgtacgg cgcgcgcttt       360
     ccggtcgtga cggtcgagga ttgggtgcat gcgcaggcgc gcgtcgccga cgcgctcggc       420
     atcgaacgct tcgccgcggt gatgggcggc agcctcggcg ggatgcaggc gctcgcgtgg       480
     agcctgctgt atccggagcg ggtcgcgcac tgcatcgaca tcgcgtcgac gcccaagctc       540
     tccgcgcaga acatcgcgtt caacgaagtc gcacgctcgg cgatcctgtc ggaccccgat       600
     ttccacggcg gcgactacta cgcgcacggc gtgaagccgc ggcgcggcct gcgcgtcgcg       660
     cggatgatcg gccacatcac gtatctgtcg gacgacgaca tggccgagaa attcggccgc       720
     gcgctgcgcc gcgcggacgg cgcgctcgac gcgtacaact tcaatttcga cgtcgagttc       780
     gaagtcgagt cgtacctgcg ctaccagggc gacaagttcg ccgactactt cgacgcgaac       840
     acgtacctgc tgatcacccg cgcgctcgat tacttcgatc cggcgaaggc gttcaacggc       900
     gacctgagcg cggcgctcgc gcatacgaag gcgaagtatc tgatcgcgag cttcatgacc       960
     gactggcgct tcgctcccgc gcgttcgcgc gagatcgtga aggcgctgct cgacaaccgg      1020
     cgctcggtat cgtacgcgga gatcgacgcg ccgcacgggc acgacgcgtt cctgctcgac      1080
     gacgcgcgct accacaacct ggtgcgcgcc tattacgaac ggattgccga ggaggtgggc      1140
     gcatga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page