(data stored in SCRATCH9089 zone)

EMBL: CP000124.MOTB

CP000124.MOTB        Location/Qualifiers
FT   CDS_pept        complement(82067..83089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="BURPS1710b_0079"
FT                   /product="MotB"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48892"
FT                   /db_xref="GOA:Q3JY57"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY57"
FT                   /protein_id="ABA48892.1"
FT                   /translation="MSKGKDQAIIVKRVNQQKKGHHGGAWKLAYADFMTAMMAFFLLMW
FT                   LLSAVTPVQLKGIAEYFNTPLKAAIFGSGDRSADDASIIKGGGRDISSLDAGTTRRTDG
FT                   STHLAERVAKKSEDDALAQAQGSLERREQVRLHDLQVKLMAAIEANPTLRQFKQQIRID
FT                   STLMGLRIEIVDTQKRPMFAMSSDAVEPYMRDILREIGKTLNDVPNRIIVQGHTDAVPY
FT                   AGGEKGYSNWELSADRANASRRELIAGGMDEAKVLRVLGLASTQNLNKADPLDPENRRI
FT                   SIIVLNRKSELALMRDDATTTTLSSDAAGSARLAQQITPPGAAAMPALPGASGLAVQKP
FT                   "
     atgagcaagg gcaaggatca ggcgatcatc gtcaagcggg tgaaccagca gaagaagggg        60
     caccacggcg gcgcatggaa gctcgcgtat gcggacttca tgaccgcgat gatggcgttc       120
     ttcctgttga tgtggctgct gtccgccgtg acgcccgtgc agttgaaggg gatcgccgag       180
     tacttcaaca cgccgctgaa ggcagcgatc ttcggcagcg gcgatcgcag cgccgacgat       240
     gcgagcatca tcaagggcgg cggccgcgac atttcgagcc tcgatgccgg cacgacccgc       300
     cgcaccgacg gctcgacgca cctggccgag cgcgtcgcga agaagagcga ggacgacgcg       360
     ctcgcgcagg cgcagggctc gctcgagcgc cgcgagcagg tgcggctgca cgatctgcag       420
     gtgaagctga tggcagccat cgaggcgaat ccgacgctgc gccagttcaa gcagcagatc       480
     cgcatcgatt cgacgctgat ggggctgcgc atcgaaatcg tcgatacgca gaaacggccg       540
     atgttcgcga tgtcgagcga cgccgtcgag ccgtacatgc gcgacatcct gcgcgagatc       600
     ggcaagacgc tcaacgacgt gccgaaccgc atcatcgtcc agggccacac cgacgccgtg       660
     ccgtatgcgg gcggcgagaa gggctacagc aactgggagc tgtccgccga ccgggcgaac       720
     gcgtcgcgcc gcgagctgat cgcgggcggc atggacgagg cgaaggtgct gcgcgtgctc       780
     ggcctcgcgt cgacgcagaa cctgaacaag gcggacccgc tcgatccgga gaaccgccgg       840
     atcagcatca tcgtgctgaa ccgcaagtcc gagctcgcgc tgatgcgcga cgacgcgacg       900
     acgacgacgc tgtcgtccga cgcggccggc tcggcgcggc tcgcgcaaca gatcacgccg       960
     cccggtgcgg ccgcgatgcc cgcgttgccg ggcgcgtcgg gcctcgccgt gcagaaaccc      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page