(data stored in SCRATCH9089 zone)

EMBL: CP000124.MRDB

CP000124.MRDB        Location/Qualifiers
FT   CDS_pept        complement(376618..377766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdB"
FT                   /locus_tag="BURPS1710b_0362"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="identified by match to protein family HMM PF01098;
FT                   match to protein family HMM TIGR02210"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49226"
FT                   /db_xref="GOA:Q3JXC7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXC7"
FT                   /protein_id="ABA49226.1"
FT                   /translation="MQFDKRASLDKIKQMFAGFDRPLALIVFLLLCVGIVTLYSASVDV
FT                   PGRVEDQLRNIMLTFVLMWMIANIPPQTLMRFAVPLYSFGVALLVAVALFGMTKKGAKR
FT                   WLNVGVVIQPSEILKIATPLMLAWYYQRRESSLRWYDFVVAFAILMVPVGLIAKQPDLG
FT                   TAVLVFAAGLFVIYLAGLSFKLIVPVLVAGVLAVGSIAVFEERICQPEVVWPLMHDYQK
FT                   HRVCTLLDPTSDPLGKGFHTIQAVIAIGSGGPLGKGYLKGTQAHLEFIPEKHTDFIFAV
FT                   FSEEFGLVGGLVLLTLYMALIARGLYIAAQGATLFGRLLAGSLTLAFFVYAFVNIGMVS
FT                   GVLPVVGVPLPFMSYGGTALTTLGIAVGLIMSVGRQKRLMKS"
     atgcaattcg acaagcgcgc ctcgctcgac aagatcaagc agatgttcgc gggcttcgac        60
     cggccgctcg cgctcatcgt gttcctgctg ctgtgcgtcg gcatcgtcac gctgtacagc       120
     gcgagcgtcg acgtgccggg gcgcgtcgag gaccagttgc gcaacatcat gctgacgttc       180
     gtgctgatgt ggatgatcgc gaacatcccg ccgcaaacgc tgatgcgctt cgcggtgccg       240
     ctctattcgt tcggcgtcgc gctgctcgtc gcggtggcgc tattcggcat gacgaagaag       300
     ggcgcgaagc gctggctgaa cgtcggcgtc gtgatccagc cgtccgagat cctcaagatc       360
     gcgacgccgc tgatgctcgc gtggtactac cagcggcgcg aaagcagcct gcgctggtac       420
     gacttcgtcg tcgcgttcgc catcctgatg gtgcccgtcg ggctgatcgc gaaacagccg       480
     gatctcggca ccgccgtgct cgtgttcgcc gcgggcctgt tcgtgatcta tctcgcgggg       540
     ctgtcgttca agctgatcgt gccggtgctc gtcgccggcg tgctcgcggt cggctcgatc       600
     gccgtgttcg aggagcgcat ctgccagccc gaagtcgtct ggccgctgat gcacgactat       660
     cagaaacacc gcgtctgcac gctgctcgat ccgacgtccg acccgctcgg caaaggcttc       720
     cacacgatcc aggcggtgat cgcgatcggc tcgggcggcc cgctcggcaa ggggtatctg       780
     aagggcacgc aggcgcacct cgaattcatt ccggaaaagc acaccgattt catcttcgcg       840
     gtgttttccg aggaattcgg gctcgtcggc gggctcgtgc tgctgacgct gtacatggcg       900
     ctgatcgcgc gcgggctcta catcgccgcg cagggcgcga cgctgttcgg gcggctgctc       960
     gccggctcgc tcacgctcgc gttcttcgtc tacgcgttcg tcaatatcgg aatggtgagc      1020
     ggcgtgctgc ccgtcgtcgg cgtgccgctg ccgttcatga gctacggcgg cacggcgctc      1080
     acgacgctcg gcatcgccgt cgggctcatc atgagcgtcg ggcggcagaa gcggctgatg      1140
     aagagttga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page