(data stored in SCRATCH9089 zone)

EMBL: CP000124.MREC

CP000124.MREC        Location/Qualifiers
FT   CDS_pept        complement(380882..381955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="BURPS1710b_0365"
FT                   /product="rod shape-determining protein"
FT                   /note="identified by match to protein family HMM PF04085;
FT                   match to protein family HMM TIGR00219"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48228"
FT                   /db_xref="GOA:Q3JXC4"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXC4"
FT                   /protein_id="ABA48228.1"
FT                   /translation="MEYSPPPLFKQGPSALARLIFFVVLAIALLVSDARFNTLEIVRGV
FT                   LGTVLYPLQRAALVPRDLIVGAAELATSSTALRHENQQLRDRNLKLSLQANQAGQLAAD
FT                   NAHLRAVLELRQQIAAQATPVEIQYDTGDPFSQKIIIGHGSQAGIQDGAPVVNEDGVIG
FT                   QVTRVFPLQSEVTLVTDRDLAIPVQVLRTGLRSVIYGTPKGDALDLRFVPTSADLLAGD
FT                   ELVTSGLDGVYPPGLPVAKVVRVDKLADTAFAHVVCAPIAAVRGAREMLVLHYRNDIPP
FT                   PPVTDDAASDAKAAKGKKATKGADKSAKAADKGADKDKGAKPAAAPPVPARSRPAGPAQ
FT                   PAAPLKPATAPSPGAPR"
     atggaataca gtccgccgcc cctgttcaaa caaggtccgt ccgcgctcgc gcggctgatc        60
     ttcttcgtcg tcctggcgat cgcgctcctc gtctcggacg cgcgcttcaa cacgctcgaa       120
     atcgtccgag gcgtgctcgg caccgtgctc tatccgctgc agcgcgcggc gctcgtgccg       180
     cgcgacctga tcgtcggcgc ggccgagctc gcgacgtcga gcaccgcgct gcgccacgaa       240
     aaccagcagt tgcgcgaccg caatctgaag ctgtcgctgc aggcgaacca ggcgggccag       300
     ctcgccgccg acaacgcgca cctgcgcgcg gtgctcgagc tgcgccagca gattgccgcg       360
     caggcgacgc ccgtcgagat ccagtacgac acgggcgatc cgttctcgca gaagatcatc       420
     atcggccacg gctcgcaggc gggcatccag gacggcgcgc ccgtcgtcaa cgaggatggc       480
     gtgatcggcc aggtcacgcg cgtgtttccg ctgcaatcgg aagtcacgct cgtcaccgac       540
     cgcgacctcg cgattcccgt gcaggtgctg cgcaccgggc tgcgcagcgt gatctacggc       600
     acgccgaagg gcgatgcgct cgatctgcgc ttcgtgccga cgagcgccga tctgctcgcg       660
     ggcgacgagc tcgtgacgag cggcctcgac ggcgtttatc cgccggggct gccggtcgcg       720
     aaggtggtgc gcgtcgacaa gctcgccgat accgccttcg cgcacgtcgt ctgcgcgccg       780
     atcgccgcgg tgcgcggcgc gcgcgagatg ctcgtgctgc actaccgcaa cgacatcccg       840
     ccgccccccg tcaccgacga cgccgcgagc gacgcgaagg ccgccaaggg caaaaaggcg       900
     acgaagggcg cggacaagag cgcgaaggcc gccgataaag gcgcggacaa ggacaagggc       960
     gcaaagccgg ccgccgcgcc gcccgtgccc gcgcggagcc ggccggccgg ccccgcgcaa      1020
     cccgccgcgc cgctcaagcc cgcgaccgcg ccgtcgccag gagcgccgcg atga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page