(data stored in SCRATCH9089 zone)

EMBL: CP000124.OMPW

CP000124.OMPW        Location/Qualifiers
FT   CDS_pept        31191..32021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompW"
FT                   /locus_tag="BURPS1710b_0026"
FT                   /product="outer membrane protein, OmpW family"
FT                   /note="identified by match to protein family HMM PF03922"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50615"
FT                   /db_xref="GOA:Q3JYA9"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYA9"
FT                   /protein_id="ABA50615.1"
FT                   /translation="MRKALCTALGVAALTPLAAHAQSAGSNVVTLGWFHVMPQQSSTPL
FT                   TTNVAPTPINTPLRLPPSFTSAGTGLSTSGADTVGLTVSHFLTDHIAVTSVAGVPPVFK
FT                   VSGHGTITPPGPAGALGTQNIGLAQVNPIVKSVRQWSPAVVFQYYFAQATAKFRPFVGI
FT                   GVSYNWFSDLQLNTNFIKQTQDNLGAILAAGAGKPGVTQVSAKASSSWQPVFNAGLSYN
FT                   ITDHWGLVASVTYIPLKTTSTVTIKAADGTTLAESKSDLKADPIISYVAVSYKF"
     atgagaaaag cactctgcac ggcgctcggc gtcgcggcgc tgacgccgct cgccgcgcac        60
     gcgcaaagcg cgggcagcaa cgtcgtcacg ctcggctggt ttcacgtgat gccgcagcaa       120
     agcagcacgc cgcttacgac gaatgtcgcg ccgacgccga tcaacacgcc gctgcgtttg       180
     ccgccgtcgt tcacgtcggc gggcaccggg ctttcgacga gcggcgcgga caccgtcggc       240
     ctgaccgtca gccactttct gaccgaccac atcgcggtta cctcggtggc gggcgtgccg       300
     cccgtcttca aggtgtccgg ccacggcacg atcacgccgc ccggcccggc cggcgcgctc       360
     ggcacgcaga acatcgggct cgcccaggtc aatccgatcg tgaagagcgt gcggcagtgg       420
     agccccgccg tcgtattcca gtactacttc gcgcaagcca ccgcgaagtt ccggccgttc       480
     gtcggcatcg gcgtgtcgta caactggttc agcgatctgc aactgaacac gaacttcatc       540
     aagcagacgc aggacaacct cggcgcgatt ctcgccgcgg gcgcgggcaa gccgggggtc       600
     acgcaggtat cggcgaaggc gtcgtcgtcg tggcagccgg tgttcaatgc gggcctgtcg       660
     tacaacatca ccgatcattg ggggctcgtc gcatcggtca cgtacatccc gctgaagacg       720
     acgtcgacgg tgacgatcaa ggcggccgac ggcacgacgc tcgccgagtc gaaatcggat       780
     ctgaaggccg atccgatcat cagctacgtg gcggtgtcgt acaagttctg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page