(data stored in SCRATCH9089 zone)

EMBL: CP000124.OPMB

CP000124.OPMB        Location/Qualifiers
FT   CDS_pept        complement(243225..244841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opmB"
FT                   /locus_tag="BURPS1710b_0232"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50714"
FT                   /db_xref="GOA:Q3JXQ5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ5"
FT                   /protein_id="ABA50714.1"
FT                   /translation="MPQVPHPRARRALSAAVAAATAVLLAGCAVGPDYHRPDAAIPAAY
FT                   KEAPPGWKLAQPADRADRGPWWSIYDDAQLNALIDKLNASNQTVAQYAAAYRQARALVA
FT                   EARASYFPTLGLTASESRASSALSSGTASRGTTRTVGNTYSVGLDASWEPDLWGKVSRT
FT                   VGAQKAGEAAAAADLANARLSAQATLAQTYFQLRAADATQKLLDDTVESYRKSLQLTQN
FT                   QYAQGVAARADVIQAQTQLQSAQAAAIDNGIARAQYEHAIATLVGEPAPTFSLPPMPLT
FT                   AEPPAMPIDVPSAILERRPDVAAAERRAAAANEQIGVAIAAFFPTLTLSASGGFQSSVW
FT                   SQLFTLPARFWSVGPQLAATLFDAGLRAAQTEAARATYDQDVAAYRAAVLSAFQDVEDN
FT                   LASQRILEQEIVVQRQAVESAQHSLDITLNQYKAGTVGYLNVLTAQTTAFSARQKLAAL
FT                   SGQRMVSSVGLVKALGGGWDGSQIARETGGMQAPAAPAGASAPAAMPAAAVAPAARPAA
FT                   VVAAAGPDTQARRPRATPAAQ"
     atgccgcaag tcccacatcc gcgcgcgcgc cgcgcgttga gcgccgccgt cgccgcggcc        60
     accgccgtgc tgctcgccgg ctgcgcggtc gggcccgact atcaccgccc cgacgcggcg       120
     attcccgccg cgtacaagga agcgccgccc ggctggaagc tcgcgcagcc ggccgaccgc       180
     gcggaccgcg gcccgtggtg gtcgatctac gacgatgcgc aactgaatgc gctgatcgac       240
     aagctcaacg cgtcgaacca gaccgtcgcg caatacgcgg ccgcgtaccg gcaggcgcgc       300
     gcgctcgtcg ccgaggcgcg cgcgtcgtac tttccgacgc tcgggctgac cgcgagcgaa       360
     tcgcgcgcgt cgagcgcgct gtcgtcgggc accgcgtcgc gcggcacgac gcgcacggtc       420
     ggcaacacgt acagcgtcgg cctcgatgcg tcgtgggagc cggacctgtg gggcaaggtg       480
     agtcgcacgg tcggcgcgca gaaggcagga gaagcggccg cggccgccga tctcgcgaac       540
     gcgcggctgt ccgcgcaggc gacgctcgcg cagacctact tccagctgcg cgccgcggac       600
     gcgacgcaaa agctgctcga cgacaccgtc gagtcgtacc ggaaatcgct gcagctcacg       660
     cagaaccagt acgcgcaggg cgtcgccgcg cgcgcggacg tgatccaggc gcagacccag       720
     ctccaatcgg cgcaggccgc cgcgatcgac aacggcatcg cgcgcgcgca gtacgagcac       780
     gcgatcgcga cgctcgtcgg cgagccggcg ccgacgttct cgctgccgcc gatgccgctc       840
     acggccgagc cgcccgcgat gccgatcgac gtgccgtcgg cgatcctcga gcggcggccc       900
     gacgtcgccg ccgccgagcg gcgcgcggcc gccgcgaacg agcagatcgg cgtcgcgatc       960
     gccgcgttct tcccgacgct cacgctgtcc gcatcgggcg gctttcagag ctcggtgtgg      1020
     tcgcagctgt tcacgctgcc cgcacgcttc tggtcggtcg gcccgcagct cgccgcgacg      1080
     ctgttcgacg cgggcctgcg cgccgcgcag acggaagcgg cgcgcgcgac ctacgatcag      1140
     gacgtcgccg cgtaccgggc ggccgtgctc tccgcgttcc aggacgtcga ggacaacctc      1200
     gcgtcgcagc gcatcctcga gcaggaaatc gtcgtgcagc ggcaggcggt cgaatccgcg      1260
     cagcactcgc tcgacatcac gctcaaccag tacaaggcgg gcaccgtcgg ctatctgaac      1320
     gtgctgaccg cgcagacaac cgcgttcagc gcgcggcaga agctcgcggc cctctccggg      1380
     cagcggatgg tgtcgtcggt cggactcgtg aaagcgctcg gcggcggatg ggacgggtcg      1440
     cagatcgcgc gcgagacagg cggcatgcag gcgcccgccg cgccggccgg ggcgtcggcg      1500
     ccggcggcca tgccggccgc ggccgttgcg ccggcggcac gcccggcggc cgtggtcgcg      1560
     gcggccgggc ccgatacgca ggctcgccgg ccgcgcgcca cgcccgccgc gcaatag         1617
//

If you have problems or comments...

PBIL Back to PBIL home page