(data stored in SCRATCH9089 zone)

EMBL: CP000124.PAAB

CP000124.PAAB        Location/Qualifiers
FT   CDS_pept        8747..9691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaB"
FT                   /locus_tag="BURPS1710b_0008"
FT                   /product="phenylacetic acid degradation protein PaaB"
FT                   /note="identified by match to protein family HMM PF06243;
FT                   match to protein family HMM TIGR02157"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47972"
FT                   /db_xref="InterPro:IPR009359"
FT                   /db_xref="InterPro:IPR038693"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYC7"
FT                   /protein_id="ABA47972.1"
FT                   /translation="MGGCRRDRLARRRRGDHEPGSALPLHVRPVCARDDPRLQGGIVPS
FT                   AARLRRAARDDEGHRRAARDGPGSRGPLVVARADDVRAARRRFRAQQPVGQMGDQADFE
FT                   RRPAAEIRRRDGRAGEGARRHAARSGPQVERRPRPFRLRRARLGRILARRQRRRPVQQG
FT                   APRDPREGSRKRRVGSRRRARARGKAPPSRAATSGLTGMTRGKRGAAIRIQEIQEKAMN
FT                   NEWPIWEVFVRSKQGLDHKHCGSLHAADASMALRMARDVYTRRREGVSIWVVPSAAITA
FT                   SDPNEKAEMFEPAGDKIYRHPTFYTLPDEVNHM"
     gtgggcggat gtcggcgtga tcggctggct cgtcgacggc gcggcgatca tgaaccaggt        60
     tccgctctgc cgctgcacgt acggcccgta tgcgcgcgcg atgatccgcg tctgcaagga       120
     ggaatcgttc catcagcggc aaggcttcga cgcgctgctc gcgatgatga agggcaccga       180
     cgcgcagcgc gcgatggtcc aggaagccgt ggaccgctgg tggtggcccg tgctgatgat       240
     gttcgggccg cccgacgccg attccgtgca cagcaaccag tcggccaaat gggggatcaa       300
     gcggatttcg aacgacgacc tgcggcagaa attcgtcgac gcgacggtcg agcaggcgaa       360
     ggtgctcggc gtcacgctgc ccgatccgga cctcaagtgg aacgacgccc gcggccattt       420
     cgattacggc gcgctcgact gggacgaatt ctggcgcgtc gtcaacggcg acggcccgtg       480
     caacaaggag cgcctcgcga cccgcgtgaa ggctcacgaa aacggcgcgt gggttcgcga       540
     cgccgcgctc gcgcacgagg aaaagcgccg ccgtcgcgcg cagcaacaag cggcctaacc       600
     ggcatgacgc gcggcaagcg cggtgccgcg atccgcattc aggagattca ggagaaagcg       660
     atgaacaacg aatggcccat ctgggaagtt ttcgtgcgca gcaagcaagg gctcgaccac       720
     aagcactgcg gaagcctgca cgcggccgac gcgtcgatgg cgctgcgcat ggcgcgcgac       780
     gtctacacgc gccgccggga aggcgtgagc atctgggtcg tgccgtcggc ggcaatcacc       840
     gcgtccgatc cgaacgagaa ggccgagatg ttcgaaccgg cgggcgacaa gatctatcgt       900
     catccgacgt tctacacgct gcccgacgaa gtcaaccaca tgtga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page