(data stored in SCRATCH9089 zone)

EMBL: CP000124.PAAR

CP000124.PAAR        Location/Qualifiers
FT   CDS_pept        13230..13829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaR"
FT                   /locus_tag="BURPS1710b_0013"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49986"
FT                   /db_xref="GOA:Q3JYC2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYC2"
FT                   /protein_id="ABA49986.1"
FT                   /translation="MARTRAPDHESQREQILDLAAAKFAQTSYPSTSMTDLANASGTSK
FT                   ARLYHYYEGKEAILFDLLDRYTKRLMLIIAEVEGASQRRGLTEREAFAELVRAFLAEYE
FT                   TSHSRHVALLNDVKYLEDTQRQIVLDRQRDIVAAFARQLARAYPERISKDNQTPVTMMV
FT                   FGMINWTFTWLKPGGRLGYRDFAEQVIGMIEHGLGG"
     atggcccgca cccgcgcccc cgatcacgaa tcccagcgcg agcagatcct cgatctcgcc        60
     gccgccaagt ttgcgcagac gagctacccg agcacgtcga tgaccgatct cgcgaacgcg       120
     agcggcacgt cgaaggcgcg cctctatcac tattacgagg gcaaggaagc gatcctgttc       180
     gatctgctcg accgctacac gaagcggttg atgctgatca tcgccgaggt cgaaggcgcg       240
     agccagcggc gcgggctcac cgagcgcgaa gcgttcgccg agctcgtgcg cgcgtttctc       300
     gccgaatatg agacgtcgca cagccgccat gtcgcgctgc tgaacgacgt gaagtacctc       360
     gaggacacgc agcgccagat cgtcctcgac cgccagcgcg acatcgtcgc cgcgttcgcg       420
     cgccagctcg cgcgcgcgta tccggaacga atctcgaaag acaaccagac gcccgtgacg       480
     atgatggtgt tcgggatgat caactggacc ttcacgtggc tgaagcccgg cggccgcctc       540
     ggctatcgcg atttcgccga gcaggtgatc ggcatgatcg agcacgggct tggcggctga       600
//

If you have problems or comments...

PBIL Back to PBIL home page