(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE103

CP000124.PE103       Location/Qualifiers
FT   CDS_pept        complement(110190..110867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0109"
FT                   /product="CsgG family protein"
FT                   /note="identified by match to protein family HMM PF03783"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49268"
FT                   /db_xref="GOA:Q3JY27"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY27"
FT                   /protein_id="ABA49268.1"
FT                   /translation="MKTSKTVLACLAASAIVALSGCATEASRTLPVPPSASAQKPFAGK
FT                   PVGIAVGKFDNRSSYMRGIFTDGVDRLGSQAKTILVTQLQQSRRFNVLDRENLDEIKQE
FT                   AAFMKKAQAVKGANYVVTGDVTEFGRKEVGDQQLFGILGRGKSQIAYAKVNLNIVDTTT
FT                   SEVVLSSQGAGEYSLSNREIIGFGGTAGYDSTLNGKVLDLAIQDAVNHLVEQVDAGALA
FT                   SGK"
     ttgaaaactt cgaagacagt tctggcgtgc ctcgcggcat cggccatcgt cgcattgtcc        60
     ggctgcgcga ccgaggcgtc gcgcacgctg cccgtgccgc cgtcggcgag cgcgcagaag       120
     ccgttcgccg gcaagccggt cggcatcgcg gtcggcaagt tcgacaaccg ttcgagctac       180
     atgcgcggca tcttcaccga cggcgtcgac cgcctgggca gccaggcgaa gacgatcctc       240
     gtcacgcagc tccagcagag ccgccgcttc aacgtgctcg atcgcgagaa cctcgacgag       300
     atcaagcagg aagccgcgtt catgaagaag gcgcaggcgg tgaagggcgc gaactatgtc       360
     gtgacgggcg acgtcaccga gttcggccgc aaggaagtcg gcgatcagca gctgttcggc       420
     attctcggcc gcggcaagag ccagatcgcg tacgcgaagg tgaatctgaa catcgtcgac       480
     acgacgacgt cggaagtcgt tctgtccagc cagggcgcgg gcgaatacag cctgtcgaac       540
     cgcgagatca tcggcttcgg cggcacggcc ggctatgact cgacgctcaa cggcaaggtg       600
     ctcgatctcg cgatccagga cgcggtcaat cacctcgtcg aacaggtcga cgcgggcgcg       660
     ctcgcgtccg gcaagtag                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page