(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE104

CP000124.PE104       Location/Qualifiers
FT   CDS_pept        110701..110895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0110"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48456"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY26"
FT                   /protein_id="ABA48456.1"
FT                   /translation="MSNLPTAMPTGLPANGFCALADGGTGSVRDASVAQPDNATMADAA
FT                   RHARTVFEVFKRWSLLGDR"
     ttgtcgaact tgccgaccgc gatgccgacc ggcttgccgg cgaacggctt ctgcgcgctc        60
     gccgacggcg gcacgggcag cgtgcgcgac gcctcggtcg cgcagccgga caatgcgacg       120
     atggccgatg ccgcgaggca cgccagaact gtcttcgaag ttttcaaacg atggtccctc       180
     cttggagatc gctaa                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page