(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE111

CP000124.PE111       Location/Qualifiers
FT   CDS_pept        complement(122160..122477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0117"
FT                   /product="putative DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49498"
FT                   /db_xref="GOA:Q3JY19"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY19"
FT                   /protein_id="ABA49498.1"
FT                   /translation="MKRASAEGFNLIQHTVDDTEHLLAKPGVRAAYDALEDEYMALRAI
FT                   LAIRHEAGLTQAQVAERMGTTASAVSRLEASLSSEKHSPSFATLRKYAAAFGKRLVISF
FT                   A"
     gtgaagcgtg ctagtgctga aggcttcaac ctgatccagc acacggtaga tgatacggag        60
     catctgctgg caaagccggg agtcagagcg gcgtatgatg ctctggaaga tgagtacatg       120
     gccctgcggg ccattttggc tattcggcat gaggccggat tgacgcaagc tcaagtggca       180
     gagcgcatgg gaactacggc gtcagcggtt tcgcgacttg aggcatctct gtctagtgaa       240
     aagcactcac cctcttttgc gacgctgcgc aagtatgctg ctgcgtttgg caagagatta       300
     gtgatttcgt ttgcttaa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page