(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE112

CP000124.PE112       Location/Qualifiers
FT   CDS_pept        complement(122485..122805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0118"
FT                   /product="putative bacteriophage protein"
FT                   /note="identified by match to protein family HMM PF05973"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50322"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY18"
FT                   /protein_id="ABA50322.1"
FT                   /translation="MDSRLLQRARQTRRLRAAGRDSGRLSAAPGLDAGVRRGFAYAALA
FT                   SNGGGLFELRPKGREGIGRVFYCTHVGQRVVVLHSFVKKTQETPQNELRTARVRLSEVR
FT                   NG"
     ttggacagtc gtctattaca acgagcgcgt caaacgcgac gtcttcgcgc tgccggcagg        60
     gattctggca gactatctgc ggctcctgga cttgatgcag gagttcggcg cggatttgcg       120
     tatgccgcac tcgcgagcaa tgggggcgga ctgtttgaat tgcgcccaaa aggcagggaa       180
     ggcatcgggc gcgtgtttta ctgcacccat gttggacagc gggtcgtggt cctgcattcg       240
     tttgtgaaga aaacgcagga gacgcctcag aatgagctgc gaaccgctcg ggtgcgttta       300
     agtgaggtgc gtaatggcta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page